Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433CMG1

Protein Details
Accession A0A433CMG1    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
122-143TEEFTRQKGKGRQQKKGVLFHGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17, cyto_nucl 14, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR003146  M14A_act_pep  
IPR000834  Peptidase_M14  
Gene Ontology GO:0004181  F:metallocarboxypeptidase activity  
GO:0008270  F:zinc ion binding  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00246  Peptidase_M14  
PF02244  Propep_M14  
Amino Acid Sequences MFESPPCNQELHLDLWSHLRPGSIDIRVPPSLFSTFTSMLPAHLAPSIKIPDLQQYLDSIPVFASDNSHNDDFFKAYHEYNEILEFTKALADKHDFVDLVTVGKTYEGKDIVGIKFTGGNGTEEFTRQKGKGRQQKKGVLFHGGQHAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.27
4 0.24
5 0.21
6 0.17
7 0.15
8 0.18
9 0.23
10 0.2
11 0.21
12 0.23
13 0.28
14 0.28
15 0.28
16 0.24
17 0.22
18 0.21
19 0.2
20 0.2
21 0.2
22 0.2
23 0.2
24 0.22
25 0.19
26 0.17
27 0.18
28 0.16
29 0.11
30 0.12
31 0.12
32 0.1
33 0.14
34 0.15
35 0.14
36 0.15
37 0.14
38 0.18
39 0.2
40 0.2
41 0.16
42 0.16
43 0.16
44 0.18
45 0.17
46 0.11
47 0.09
48 0.09
49 0.1
50 0.08
51 0.1
52 0.09
53 0.1
54 0.14
55 0.14
56 0.13
57 0.13
58 0.14
59 0.12
60 0.11
61 0.12
62 0.11
63 0.11
64 0.11
65 0.12
66 0.12
67 0.12
68 0.13
69 0.1
70 0.1
71 0.09
72 0.09
73 0.07
74 0.09
75 0.08
76 0.08
77 0.1
78 0.11
79 0.13
80 0.14
81 0.15
82 0.13
83 0.12
84 0.14
85 0.12
86 0.1
87 0.09
88 0.08
89 0.07
90 0.07
91 0.08
92 0.07
93 0.11
94 0.1
95 0.1
96 0.13
97 0.17
98 0.17
99 0.18
100 0.17
101 0.14
102 0.15
103 0.15
104 0.15
105 0.12
106 0.13
107 0.11
108 0.13
109 0.13
110 0.14
111 0.16
112 0.16
113 0.2
114 0.19
115 0.28
116 0.35
117 0.45
118 0.54
119 0.61
120 0.69
121 0.74
122 0.82
123 0.82
124 0.82
125 0.75
126 0.72
127 0.64
128 0.58