Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A432ZZ30

Protein Details
Accession A0A432ZZ30    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27KPKPKAAPKEKKEKKPKTEKAPEPEYSBasic
NLS Segment(s)
PositionSequence
2-20PKPKAAPKEKKEKKPKTEK
Subcellular Location(s) nucl 15, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences KPKPKAAPKEKKEKKPKTEKAPEPEYSNTTPAATILVPSNRQGTNGGRRSSLSWPGWQVQTRRPVRCPRTTAQHHRILAYRPGSHRRHTGLADPMPWYRSRRHLVADPTRHDVSRETFVAGVWEWKEKYAHRIYVQFKRFDRRTIGIGWSSRWVLNPPNPPARPLSVSTTKVSSIALTTSELARRTLLPVPGYEDHEKLEIDVLVQFALPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.93
4 0.93
5 0.93
6 0.92
7 0.9
8 0.87
9 0.8
10 0.74
11 0.68
12 0.63
13 0.55
14 0.47
15 0.39
16 0.31
17 0.27
18 0.21
19 0.18
20 0.12
21 0.11
22 0.13
23 0.16
24 0.17
25 0.18
26 0.23
27 0.21
28 0.22
29 0.24
30 0.26
31 0.33
32 0.39
33 0.39
34 0.36
35 0.37
36 0.39
37 0.4
38 0.42
39 0.34
40 0.3
41 0.32
42 0.34
43 0.37
44 0.38
45 0.37
46 0.35
47 0.43
48 0.47
49 0.48
50 0.52
51 0.58
52 0.61
53 0.66
54 0.66
55 0.6
56 0.63
57 0.68
58 0.71
59 0.69
60 0.69
61 0.62
62 0.58
63 0.56
64 0.49
65 0.46
66 0.39
67 0.35
68 0.32
69 0.4
70 0.41
71 0.41
72 0.43
73 0.4
74 0.4
75 0.37
76 0.37
77 0.35
78 0.33
79 0.31
80 0.28
81 0.25
82 0.23
83 0.24
84 0.22
85 0.18
86 0.23
87 0.26
88 0.26
89 0.28
90 0.32
91 0.38
92 0.44
93 0.48
94 0.43
95 0.45
96 0.44
97 0.41
98 0.36
99 0.3
100 0.24
101 0.22
102 0.2
103 0.15
104 0.14
105 0.14
106 0.15
107 0.13
108 0.12
109 0.09
110 0.11
111 0.1
112 0.11
113 0.13
114 0.13
115 0.2
116 0.23
117 0.27
118 0.27
119 0.34
120 0.39
121 0.47
122 0.51
123 0.5
124 0.48
125 0.53
126 0.52
127 0.49
128 0.48
129 0.42
130 0.39
131 0.36
132 0.37
133 0.32
134 0.31
135 0.29
136 0.26
137 0.24
138 0.22
139 0.2
140 0.19
141 0.2
142 0.26
143 0.33
144 0.36
145 0.44
146 0.44
147 0.45
148 0.46
149 0.44
150 0.41
151 0.36
152 0.37
153 0.35
154 0.38
155 0.38
156 0.37
157 0.33
158 0.3
159 0.27
160 0.21
161 0.14
162 0.12
163 0.11
164 0.11
165 0.11
166 0.13
167 0.16
168 0.17
169 0.16
170 0.17
171 0.17
172 0.19
173 0.23
174 0.25
175 0.23
176 0.23
177 0.29
178 0.3
179 0.36
180 0.35
181 0.31
182 0.29
183 0.29
184 0.28
185 0.22
186 0.22
187 0.16
188 0.13
189 0.13
190 0.12
191 0.1