Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LE25

Protein Details
Accession A0A3N4LE25    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
203-234PPPLPFPDWEKRKRCKPGKKRRIYLRQAALKKBasic
257-287EEANIKRMLKNRERKAKKRAREKAKKLAAGGBasic
NLS Segment(s)
PositionSequence
213-285KRKRCKPGKKRRIYLRQAALKKEVKKLAFEAQKQAEAERKKQEEEEANIKRMLKNRERKAKKRAREKAKKLAA
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
CDD cd22249  UDM1_RNF168_RNF169-like  
Amino Acid Sequences MFELPQTKRYAPSPPFLSHVCTQLQYTNSPTACSVRRSDLRSPSFSPPPTTTHPRLPPDAAQQKLHSLLSTLLPLELPSPSHSQSNPPSLLSNADKPPPEDEPEYDFPLFTPHPTTAITNRVVLRTPTPPPTIEDIYLTSYHALAATQHRPLTYYFSSPSPSSPLLSCAISGEDILAHARRDKWLGQTYAWRLITVPASTTKPPPLPFPDWEKRKRCKPGKKRRIYLRQAALKKEVKKLAFEAQKQAEAERKKQEEEEANIKRMLKNRERKAKKRAREKAKKLAAGGGGGAVGFDGDGDGGESARESAGVEGEKMDVDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.45
4 0.48
5 0.4
6 0.4
7 0.34
8 0.3
9 0.29
10 0.3
11 0.3
12 0.27
13 0.29
14 0.32
15 0.3
16 0.3
17 0.3
18 0.3
19 0.32
20 0.33
21 0.32
22 0.34
23 0.4
24 0.45
25 0.51
26 0.56
27 0.58
28 0.6
29 0.61
30 0.59
31 0.6
32 0.57
33 0.55
34 0.47
35 0.47
36 0.49
37 0.52
38 0.5
39 0.52
40 0.57
41 0.56
42 0.58
43 0.56
44 0.53
45 0.55
46 0.58
47 0.52
48 0.48
49 0.44
50 0.43
51 0.42
52 0.38
53 0.28
54 0.2
55 0.18
56 0.16
57 0.16
58 0.13
59 0.1
60 0.1
61 0.1
62 0.1
63 0.09
64 0.08
65 0.1
66 0.14
67 0.15
68 0.18
69 0.18
70 0.24
71 0.29
72 0.35
73 0.33
74 0.3
75 0.3
76 0.28
77 0.31
78 0.28
79 0.29
80 0.25
81 0.27
82 0.27
83 0.27
84 0.3
85 0.28
86 0.29
87 0.25
88 0.24
89 0.28
90 0.3
91 0.33
92 0.3
93 0.27
94 0.23
95 0.25
96 0.23
97 0.16
98 0.16
99 0.12
100 0.14
101 0.15
102 0.17
103 0.15
104 0.2
105 0.2
106 0.21
107 0.22
108 0.21
109 0.22
110 0.21
111 0.21
112 0.2
113 0.22
114 0.23
115 0.24
116 0.23
117 0.25
118 0.29
119 0.28
120 0.24
121 0.22
122 0.19
123 0.19
124 0.19
125 0.16
126 0.11
127 0.1
128 0.09
129 0.08
130 0.06
131 0.06
132 0.1
133 0.12
134 0.14
135 0.14
136 0.14
137 0.15
138 0.16
139 0.2
140 0.17
141 0.17
142 0.16
143 0.17
144 0.19
145 0.18
146 0.19
147 0.16
148 0.15
149 0.14
150 0.13
151 0.14
152 0.14
153 0.13
154 0.13
155 0.1
156 0.09
157 0.08
158 0.08
159 0.06
160 0.04
161 0.04
162 0.05
163 0.06
164 0.06
165 0.07
166 0.08
167 0.09
168 0.12
169 0.13
170 0.18
171 0.23
172 0.25
173 0.25
174 0.3
175 0.32
176 0.37
177 0.36
178 0.3
179 0.24
180 0.24
181 0.25
182 0.19
183 0.17
184 0.12
185 0.15
186 0.17
187 0.18
188 0.2
189 0.22
190 0.23
191 0.26
192 0.3
193 0.32
194 0.34
195 0.41
196 0.47
197 0.52
198 0.6
199 0.65
200 0.66
201 0.71
202 0.79
203 0.8
204 0.82
205 0.85
206 0.87
207 0.89
208 0.92
209 0.92
210 0.92
211 0.93
212 0.9
213 0.88
214 0.86
215 0.84
216 0.78
217 0.72
218 0.7
219 0.65
220 0.62
221 0.59
222 0.56
223 0.48
224 0.46
225 0.45
226 0.46
227 0.47
228 0.45
229 0.46
230 0.42
231 0.45
232 0.43
233 0.41
234 0.4
235 0.36
236 0.4
237 0.41
238 0.41
239 0.4
240 0.41
241 0.46
242 0.46
243 0.47
244 0.51
245 0.47
246 0.47
247 0.47
248 0.48
249 0.44
250 0.44
251 0.48
252 0.48
253 0.53
254 0.6
255 0.69
256 0.78
257 0.83
258 0.88
259 0.88
260 0.88
261 0.89
262 0.89
263 0.9
264 0.91
265 0.91
266 0.91
267 0.9
268 0.85
269 0.75
270 0.71
271 0.61
272 0.5
273 0.41
274 0.3
275 0.2
276 0.15
277 0.13
278 0.07
279 0.05
280 0.03
281 0.03
282 0.03
283 0.02
284 0.03
285 0.04
286 0.04
287 0.04
288 0.05
289 0.05
290 0.06
291 0.06
292 0.06
293 0.06
294 0.06
295 0.1
296 0.11
297 0.11
298 0.11
299 0.12