Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LME9

Protein Details
Accession A0A3N4LME9   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
108-134RQLEVQQEKKRKEKTHKKKLLQLGFETHydrophilic
NLS Segment(s)
PositionSequence
116-126KKRKEKTHKKK
Subcellular Location(s) cyto 14, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR034104  Lsm1  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0000932  C:P-body  
GO:1990904  C:ribonucleoprotein complex  
GO:0000339  F:RNA cap binding  
GO:0006397  P:mRNA processing  
GO:0000956  P:nuclear-transcribed mRNA catabolic process  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01728  LSm1  
Amino Acid Sequences MMDAPLPPLPPQMFTTSAQLLDLTDKKLLVSLRDGRKFIGVLRTWDQYANLVLQNTVERIIVDDMYCDIKRGVFIVRGENVLLLGEIDLDKEDFFPYRLAPHKEVFARQLEVQQEKKRKEKTHKKKLLQLGFETETEVTGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.27
4 0.26
5 0.24
6 0.21
7 0.17
8 0.2
9 0.2
10 0.17
11 0.16
12 0.16
13 0.15
14 0.18
15 0.19
16 0.15
17 0.2
18 0.27
19 0.35
20 0.4
21 0.4
22 0.38
23 0.39
24 0.37
25 0.33
26 0.33
27 0.25
28 0.25
29 0.28
30 0.29
31 0.28
32 0.28
33 0.26
34 0.19
35 0.18
36 0.15
37 0.13
38 0.11
39 0.1
40 0.1
41 0.1
42 0.09
43 0.09
44 0.07
45 0.06
46 0.07
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.1
53 0.1
54 0.09
55 0.08
56 0.08
57 0.08
58 0.09
59 0.09
60 0.1
61 0.11
62 0.13
63 0.14
64 0.14
65 0.14
66 0.13
67 0.12
68 0.08
69 0.07
70 0.04
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.06
81 0.07
82 0.08
83 0.08
84 0.13
85 0.2
86 0.25
87 0.27
88 0.28
89 0.32
90 0.34
91 0.36
92 0.35
93 0.32
94 0.29
95 0.27
96 0.3
97 0.3
98 0.34
99 0.38
100 0.43
101 0.49
102 0.52
103 0.6
104 0.64
105 0.69
106 0.74
107 0.79
108 0.81
109 0.84
110 0.89
111 0.89
112 0.89
113 0.9
114 0.88
115 0.83
116 0.76
117 0.72
118 0.64
119 0.55
120 0.48
121 0.37