Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LCW3

Protein Details
Accession A0A3N4LCW3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-28IPIPGAQQHKRPRRRYEEIERMYKCHydrophilic
NLS Segment(s)
PositionSequence
62-74KEIRKEWKARKKE
Subcellular Location(s) nucl 13, mito 9.5, cyto_mito 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences YSFIPIPGAQQHKRPRRRYEEIERMYKCGWQGCEKAYGTLNHLNAHVTMQAHGAKRTPEEFKEIRKEWKARKKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.76
4 0.83
5 0.83
6 0.84
7 0.84
8 0.81
9 0.81
10 0.72
11 0.66
12 0.57
13 0.49
14 0.4
15 0.33
16 0.28
17 0.24
18 0.24
19 0.22
20 0.28
21 0.26
22 0.26
23 0.24
24 0.22
25 0.22
26 0.24
27 0.23
28 0.18
29 0.19
30 0.18
31 0.16
32 0.16
33 0.13
34 0.09
35 0.09
36 0.11
37 0.14
38 0.15
39 0.16
40 0.17
41 0.17
42 0.19
43 0.23
44 0.25
45 0.23
46 0.29
47 0.32
48 0.38
49 0.46
50 0.47
51 0.53
52 0.57
53 0.64
54 0.67
55 0.74