Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LWX4

Protein Details
Accession A0A3N4LWX4   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
8-27SIPIYRPKPRRPFDLTPLTSHydrophilic
113-136NGNGNGPSRRQRRRGKPTSIPQLIHydrophilic
NLS Segment(s)
PositionSequence
121-127RRQRRRG
Subcellular Location(s) plas 23, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR025929  INSIG_fam  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF07281  INSIG  
Amino Acid Sequences MSSPTSDSIPIYRPKPRRPFDLTPLTSPSPTPEHKHDFPAWENGGPQSPTTANGATTPNEFTKRTKSVLNLTASTLFGIYSNTYSDGTEPPTPSSFFMSRTNSQVNVCDTTSNGNGNGPSRRQRRRGKPTSIPQLILRLSAMLIFGIGYGVIVMHLHNTRTFTPAWWEEIGGYNVGFLLLWGLVGVALGSLLPWIDYFLGESEGSSADGEGEGPMVDWMQVVRSIGAFLGIAYAIRKLPWQSTLQISLTLTLVNPVLWYLVDRTRAGFVLSAFVGVAGTMILSKISPDVIQAPETYTGRLTRGAAISGQSEEMLMGYISYETVGVGAWMWSVLFCSCVCFGNIGRKLAFREKDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.67
3 0.7
4 0.72
5 0.75
6 0.78
7 0.78
8 0.8
9 0.74
10 0.68
11 0.69
12 0.62
13 0.54
14 0.45
15 0.4
16 0.36
17 0.36
18 0.37
19 0.39
20 0.45
21 0.47
22 0.54
23 0.54
24 0.53
25 0.52
26 0.54
27 0.48
28 0.41
29 0.39
30 0.34
31 0.35
32 0.29
33 0.26
34 0.21
35 0.19
36 0.19
37 0.21
38 0.2
39 0.16
40 0.18
41 0.2
42 0.18
43 0.19
44 0.21
45 0.22
46 0.25
47 0.26
48 0.27
49 0.33
50 0.36
51 0.36
52 0.37
53 0.38
54 0.42
55 0.47
56 0.48
57 0.41
58 0.39
59 0.38
60 0.34
61 0.3
62 0.22
63 0.15
64 0.1
65 0.1
66 0.09
67 0.08
68 0.09
69 0.1
70 0.1
71 0.11
72 0.12
73 0.13
74 0.16
75 0.19
76 0.19
77 0.21
78 0.22
79 0.23
80 0.22
81 0.26
82 0.23
83 0.22
84 0.27
85 0.3
86 0.31
87 0.35
88 0.36
89 0.33
90 0.32
91 0.33
92 0.3
93 0.26
94 0.25
95 0.2
96 0.18
97 0.19
98 0.2
99 0.17
100 0.15
101 0.13
102 0.14
103 0.17
104 0.2
105 0.21
106 0.28
107 0.36
108 0.44
109 0.52
110 0.62
111 0.7
112 0.77
113 0.83
114 0.83
115 0.83
116 0.85
117 0.86
118 0.79
119 0.69
120 0.59
121 0.55
122 0.46
123 0.36
124 0.27
125 0.16
126 0.13
127 0.11
128 0.1
129 0.05
130 0.04
131 0.03
132 0.03
133 0.03
134 0.03
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.02
141 0.05
142 0.06
143 0.07
144 0.08
145 0.1
146 0.11
147 0.13
148 0.13
149 0.12
150 0.16
151 0.16
152 0.18
153 0.16
154 0.16
155 0.14
156 0.16
157 0.16
158 0.11
159 0.1
160 0.07
161 0.06
162 0.06
163 0.05
164 0.03
165 0.03
166 0.02
167 0.02
168 0.02
169 0.02
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.03
182 0.03
183 0.03
184 0.04
185 0.04
186 0.06
187 0.06
188 0.06
189 0.06
190 0.06
191 0.07
192 0.06
193 0.06
194 0.04
195 0.04
196 0.05
197 0.04
198 0.04
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.04
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.06
214 0.05
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.05
221 0.05
222 0.06
223 0.07
224 0.08
225 0.1
226 0.14
227 0.16
228 0.18
229 0.21
230 0.24
231 0.24
232 0.24
233 0.22
234 0.2
235 0.17
236 0.15
237 0.11
238 0.09
239 0.08
240 0.06
241 0.06
242 0.05
243 0.05
244 0.05
245 0.06
246 0.08
247 0.12
248 0.15
249 0.15
250 0.16
251 0.18
252 0.18
253 0.18
254 0.16
255 0.13
256 0.13
257 0.12
258 0.11
259 0.09
260 0.09
261 0.08
262 0.06
263 0.06
264 0.03
265 0.03
266 0.03
267 0.03
268 0.03
269 0.03
270 0.04
271 0.04
272 0.05
273 0.05
274 0.07
275 0.11
276 0.12
277 0.14
278 0.14
279 0.16
280 0.19
281 0.2
282 0.2
283 0.18
284 0.18
285 0.18
286 0.2
287 0.19
288 0.19
289 0.19
290 0.2
291 0.19
292 0.19
293 0.19
294 0.17
295 0.16
296 0.12
297 0.11
298 0.1
299 0.08
300 0.08
301 0.06
302 0.05
303 0.05
304 0.05
305 0.05
306 0.05
307 0.05
308 0.04
309 0.04
310 0.04
311 0.04
312 0.04
313 0.04
314 0.04
315 0.04
316 0.04
317 0.04
318 0.06
319 0.06
320 0.07
321 0.07
322 0.1
323 0.12
324 0.13
325 0.14
326 0.15
327 0.18
328 0.27
329 0.33
330 0.33
331 0.34
332 0.36
333 0.41
334 0.48