Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LF70

Protein Details
Accession A0A3N4LF70    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-75LLAQNNKARRKRNNPRNKPCNQPRNQPLRKQHydrophilic
NLS Segment(s)
PositionSequence
52-59ARRKRNNP
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MRVSPCIPGNPLVDNLITKENRSYEDLKGRLIGIANAGNNTNSALLAQNNKARRKRNNPRNKPCNQPRNQPLRKQHQVLETVPTARNMVIALRDMSGKTVVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.23
4 0.22
5 0.2
6 0.22
7 0.23
8 0.24
9 0.28
10 0.29
11 0.27
12 0.36
13 0.36
14 0.33
15 0.32
16 0.3
17 0.26
18 0.24
19 0.18
20 0.11
21 0.12
22 0.12
23 0.11
24 0.11
25 0.1
26 0.1
27 0.1
28 0.08
29 0.06
30 0.06
31 0.06
32 0.07
33 0.09
34 0.12
35 0.16
36 0.22
37 0.28
38 0.34
39 0.4
40 0.47
41 0.56
42 0.65
43 0.72
44 0.77
45 0.82
46 0.88
47 0.91
48 0.87
49 0.87
50 0.86
51 0.86
52 0.8
53 0.79
54 0.78
55 0.79
56 0.81
57 0.79
58 0.78
59 0.78
60 0.8
61 0.73
62 0.69
63 0.63
64 0.62
65 0.54
66 0.5
67 0.42
68 0.37
69 0.34
70 0.3
71 0.25
72 0.2
73 0.19
74 0.14
75 0.13
76 0.12
77 0.13
78 0.13
79 0.13
80 0.14
81 0.14
82 0.16