Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LE68

Protein Details
Accession A0A3N4LE68    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
10-32MESIYKCNRRHYRPRLPTQEEKHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MSLRVATFIMESIYKCNRRHYRPRLPTQEEKHQLTRWLKPTNCSVTTMLQSYVSSDFAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.4
4 0.47
5 0.55
6 0.65
7 0.7
8 0.74
9 0.77
10 0.86
11 0.85
12 0.84
13 0.84
14 0.79
15 0.79
16 0.73
17 0.67
18 0.61
19 0.52
20 0.52
21 0.47
22 0.48
23 0.45
24 0.47
25 0.45
26 0.44
27 0.5
28 0.5
29 0.47
30 0.44
31 0.39
32 0.34
33 0.36
34 0.35
35 0.29
36 0.22
37 0.21
38 0.2
39 0.19