Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1X5K6

Protein Details
Accession K1X5K6    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-93QHASSHLRPPKRKADQRVQSDSDHydrophilic
106-129GRPFDTNKYKRQKNDHPVDSRRTLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021162  Dot1  
IPR025789  DOT1_dom  
IPR030445  H3-K79_meTrfase  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0042393  F:histone binding  
GO:0140956  F:histone H3K79 trimethyltransferase activity  
GO:0000077  P:DNA damage checkpoint signaling  
GO:0006281  P:DNA repair  
GO:0034729  P:histone H3-K79 methylation  
GO:0031509  P:subtelomeric heterochromatin formation  
KEGG mbe:MBM_01079  -  
Pfam View protein in Pfam  
PF08123  DOT1  
PROSITE View protein in PROSITE  
PS51569  DOT1  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MNLFGNKNSGIKPVRGVVRTIRVQSEVQPTALPSAQRPRHEPPQRSQQSQATPARVSPSSSTASPAPSSDQHASSHLRPPKRKADQRVQSDSDDNEDGGDKNGIFGRPFDTNKYKRQKNDHPVDSRRTLRRKEAFSEADGGGFKMIHAMDAVPINKDGCPKSSLKRFKVFLQYPGASQLERFDLIPGKDKIDSIKEICEIAQIVRDVYLTASQAKAFSSTLRPLEAANNEIGTKGLGKETLQKFGIAVENYNKAVRSLFKNGSLAKNLENLHDLPYNMIEFILRQGYDRAVSPQVDLLQFYSAKDNTYGELLCPFVSRVLGETGLKSDQVFVDLGSGVGSVVLQAALQFGCESWGCEIMPKACELADKQLAEFAARCRLWGLQTGKVHLEKGDFLENDVIKAALRKADVVLVNNKVFSSETNEALRYLFLDLKDGCHIVSLQSFAVGNGRNENDLANLIQNKITGVFFDKDISWTNGTGQYFIATKDQGHLDKISAASKLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.43
4 0.42
5 0.47
6 0.51
7 0.51
8 0.47
9 0.42
10 0.43
11 0.45
12 0.47
13 0.4
14 0.36
15 0.33
16 0.31
17 0.31
18 0.32
19 0.27
20 0.23
21 0.31
22 0.37
23 0.41
24 0.47
25 0.51
26 0.59
27 0.68
28 0.7
29 0.68
30 0.73
31 0.76
32 0.74
33 0.72
34 0.69
35 0.67
36 0.69
37 0.67
38 0.61
39 0.54
40 0.51
41 0.5
42 0.42
43 0.38
44 0.31
45 0.29
46 0.27
47 0.26
48 0.28
49 0.25
50 0.27
51 0.25
52 0.23
53 0.23
54 0.22
55 0.28
56 0.28
57 0.28
58 0.26
59 0.3
60 0.33
61 0.33
62 0.4
63 0.41
64 0.46
65 0.51
66 0.57
67 0.64
68 0.7
69 0.76
70 0.77
71 0.81
72 0.81
73 0.84
74 0.85
75 0.78
76 0.7
77 0.65
78 0.56
79 0.49
80 0.4
81 0.31
82 0.22
83 0.2
84 0.17
85 0.15
86 0.15
87 0.11
88 0.11
89 0.14
90 0.15
91 0.14
92 0.14
93 0.16
94 0.2
95 0.22
96 0.28
97 0.35
98 0.4
99 0.49
100 0.59
101 0.63
102 0.65
103 0.73
104 0.77
105 0.78
106 0.83
107 0.82
108 0.81
109 0.81
110 0.8
111 0.77
112 0.75
113 0.73
114 0.71
115 0.66
116 0.67
117 0.68
118 0.66
119 0.63
120 0.64
121 0.57
122 0.51
123 0.51
124 0.4
125 0.34
126 0.29
127 0.25
128 0.16
129 0.13
130 0.11
131 0.09
132 0.08
133 0.07
134 0.07
135 0.07
136 0.08
137 0.12
138 0.12
139 0.11
140 0.11
141 0.12
142 0.13
143 0.17
144 0.17
145 0.15
146 0.19
147 0.21
148 0.28
149 0.37
150 0.46
151 0.48
152 0.54
153 0.54
154 0.56
155 0.64
156 0.59
157 0.55
158 0.53
159 0.47
160 0.4
161 0.42
162 0.37
163 0.26
164 0.24
165 0.2
166 0.14
167 0.14
168 0.13
169 0.11
170 0.14
171 0.15
172 0.22
173 0.21
174 0.21
175 0.21
176 0.21
177 0.22
178 0.21
179 0.24
180 0.18
181 0.19
182 0.18
183 0.18
184 0.17
185 0.16
186 0.13
187 0.1
188 0.12
189 0.1
190 0.09
191 0.09
192 0.09
193 0.08
194 0.08
195 0.09
196 0.07
197 0.07
198 0.08
199 0.08
200 0.08
201 0.08
202 0.09
203 0.08
204 0.09
205 0.11
206 0.14
207 0.15
208 0.15
209 0.15
210 0.14
211 0.18
212 0.17
213 0.15
214 0.12
215 0.12
216 0.12
217 0.11
218 0.1
219 0.07
220 0.07
221 0.06
222 0.06
223 0.06
224 0.06
225 0.15
226 0.16
227 0.2
228 0.2
229 0.19
230 0.19
231 0.2
232 0.23
233 0.14
234 0.14
235 0.12
236 0.14
237 0.15
238 0.15
239 0.14
240 0.11
241 0.12
242 0.13
243 0.15
244 0.19
245 0.2
246 0.22
247 0.25
248 0.27
249 0.28
250 0.28
251 0.25
252 0.2
253 0.23
254 0.22
255 0.19
256 0.19
257 0.17
258 0.18
259 0.18
260 0.17
261 0.12
262 0.12
263 0.12
264 0.1
265 0.09
266 0.06
267 0.05
268 0.06
269 0.07
270 0.06
271 0.07
272 0.08
273 0.09
274 0.09
275 0.1
276 0.11
277 0.12
278 0.13
279 0.12
280 0.13
281 0.14
282 0.14
283 0.13
284 0.11
285 0.11
286 0.11
287 0.11
288 0.14
289 0.12
290 0.12
291 0.13
292 0.13
293 0.11
294 0.13
295 0.12
296 0.09
297 0.1
298 0.09
299 0.09
300 0.09
301 0.08
302 0.07
303 0.07
304 0.07
305 0.07
306 0.08
307 0.09
308 0.09
309 0.1
310 0.11
311 0.11
312 0.12
313 0.1
314 0.1
315 0.08
316 0.09
317 0.09
318 0.07
319 0.08
320 0.07
321 0.07
322 0.06
323 0.06
324 0.04
325 0.04
326 0.04
327 0.03
328 0.03
329 0.03
330 0.03
331 0.03
332 0.04
333 0.04
334 0.04
335 0.04
336 0.04
337 0.06
338 0.06
339 0.07
340 0.07
341 0.09
342 0.09
343 0.1
344 0.12
345 0.13
346 0.14
347 0.13
348 0.13
349 0.12
350 0.14
351 0.14
352 0.19
353 0.21
354 0.21
355 0.21
356 0.22
357 0.22
358 0.21
359 0.21
360 0.16
361 0.2
362 0.19
363 0.19
364 0.19
365 0.2
366 0.2
367 0.27
368 0.29
369 0.28
370 0.3
371 0.33
372 0.36
373 0.35
374 0.35
375 0.28
376 0.26
377 0.2
378 0.21
379 0.24
380 0.2
381 0.2
382 0.26
383 0.24
384 0.23
385 0.22
386 0.19
387 0.13
388 0.15
389 0.15
390 0.12
391 0.12
392 0.13
393 0.13
394 0.18
395 0.2
396 0.22
397 0.26
398 0.28
399 0.29
400 0.28
401 0.27
402 0.23
403 0.21
404 0.19
405 0.22
406 0.19
407 0.22
408 0.24
409 0.25
410 0.25
411 0.25
412 0.24
413 0.16
414 0.16
415 0.15
416 0.13
417 0.17
418 0.17
419 0.19
420 0.21
421 0.21
422 0.18
423 0.16
424 0.16
425 0.13
426 0.15
427 0.14
428 0.12
429 0.13
430 0.13
431 0.12
432 0.16
433 0.18
434 0.17
435 0.21
436 0.22
437 0.22
438 0.22
439 0.23
440 0.19
441 0.18
442 0.17
443 0.17
444 0.18
445 0.18
446 0.19
447 0.19
448 0.18
449 0.18
450 0.17
451 0.13
452 0.16
453 0.17
454 0.17
455 0.19
456 0.19
457 0.19
458 0.23
459 0.26
460 0.23
461 0.22
462 0.24
463 0.28
464 0.27
465 0.26
466 0.22
467 0.2
468 0.19
469 0.2
470 0.21
471 0.17
472 0.17
473 0.2
474 0.26
475 0.26
476 0.28
477 0.28
478 0.26
479 0.28
480 0.3
481 0.28
482 0.25