Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1X373

Protein Details
Accession K1X373    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
274-297ASPKPLKAAKAKPDPPTRKSRRKKBasic
NLS Segment(s)
PositionSequence
277-297KPLKAAKAKPDPPTRKSRRKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012423  Eaf7/MRGBP  
Gene Ontology GO:0043189  C:H4/H2A histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG mbe:MBM_01593  -  
Pfam View protein in Pfam  
PF07904  Eaf7  
Amino Acid Sequences MPPRGKKTKGSARAPSTPAGDDDIVATALPQTEKSASNTPKPAYNILNDPWTDEQETSLFKGIIKWKPAGIHKHFRMIALSEHLRNHGYDPAVEQHTRIPGIWQKLRTIYNLDVIDDRENSFEYDDPDKFLDFKLPEKEYGEAMFMKGRRSAAQEKASEAPSSPPQLGRSSSPPVLTKRKRAETVTVKNRAGTGDTDGTRTSPALSPPPKAIRVVKNTNKPIGRLKGASAASSRRQSKETTATAETADEDEGGEETEGAVEDEGEDAEEEDGTASPKPLKAAKAKPDPPTRKSRRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.69
3 0.61
4 0.52
5 0.44
6 0.39
7 0.31
8 0.23
9 0.21
10 0.18
11 0.14
12 0.13
13 0.11
14 0.07
15 0.09
16 0.09
17 0.09
18 0.1
19 0.13
20 0.15
21 0.2
22 0.29
23 0.32
24 0.38
25 0.44
26 0.43
27 0.47
28 0.48
29 0.48
30 0.42
31 0.41
32 0.39
33 0.35
34 0.39
35 0.33
36 0.34
37 0.31
38 0.3
39 0.28
40 0.23
41 0.22
42 0.18
43 0.2
44 0.18
45 0.18
46 0.16
47 0.14
48 0.2
49 0.26
50 0.3
51 0.32
52 0.32
53 0.31
54 0.37
55 0.43
56 0.47
57 0.48
58 0.52
59 0.51
60 0.58
61 0.56
62 0.52
63 0.47
64 0.39
65 0.33
66 0.29
67 0.3
68 0.25
69 0.25
70 0.26
71 0.25
72 0.23
73 0.23
74 0.19
75 0.17
76 0.14
77 0.16
78 0.19
79 0.21
80 0.21
81 0.2
82 0.19
83 0.2
84 0.2
85 0.18
86 0.17
87 0.19
88 0.26
89 0.3
90 0.29
91 0.29
92 0.33
93 0.35
94 0.32
95 0.32
96 0.26
97 0.28
98 0.26
99 0.25
100 0.21
101 0.21
102 0.21
103 0.17
104 0.17
105 0.11
106 0.11
107 0.11
108 0.11
109 0.1
110 0.12
111 0.15
112 0.14
113 0.15
114 0.15
115 0.15
116 0.15
117 0.14
118 0.16
119 0.13
120 0.16
121 0.2
122 0.21
123 0.22
124 0.23
125 0.24
126 0.19
127 0.19
128 0.17
129 0.11
130 0.11
131 0.12
132 0.12
133 0.12
134 0.13
135 0.13
136 0.12
137 0.18
138 0.22
139 0.26
140 0.31
141 0.31
142 0.31
143 0.33
144 0.33
145 0.28
146 0.23
147 0.19
148 0.16
149 0.17
150 0.16
151 0.15
152 0.15
153 0.17
154 0.18
155 0.18
156 0.2
157 0.22
158 0.23
159 0.24
160 0.25
161 0.29
162 0.38
163 0.4
164 0.45
165 0.49
166 0.53
167 0.55
168 0.54
169 0.58
170 0.58
171 0.64
172 0.64
173 0.64
174 0.58
175 0.54
176 0.52
177 0.44
178 0.35
179 0.26
180 0.21
181 0.18
182 0.18
183 0.19
184 0.19
185 0.19
186 0.18
187 0.17
188 0.14
189 0.11
190 0.13
191 0.2
192 0.22
193 0.24
194 0.29
195 0.34
196 0.33
197 0.35
198 0.4
199 0.39
200 0.45
201 0.54
202 0.56
203 0.61
204 0.65
205 0.69
206 0.64
207 0.59
208 0.59
209 0.54
210 0.51
211 0.42
212 0.39
213 0.39
214 0.38
215 0.37
216 0.31
217 0.3
218 0.32
219 0.38
220 0.41
221 0.36
222 0.37
223 0.38
224 0.42
225 0.45
226 0.43
227 0.41
228 0.38
229 0.37
230 0.35
231 0.33
232 0.27
233 0.2
234 0.16
235 0.11
236 0.08
237 0.08
238 0.07
239 0.08
240 0.07
241 0.05
242 0.05
243 0.05
244 0.06
245 0.05
246 0.05
247 0.04
248 0.05
249 0.05
250 0.05
251 0.05
252 0.05
253 0.05
254 0.06
255 0.06
256 0.06
257 0.06
258 0.06
259 0.07
260 0.08
261 0.09
262 0.12
263 0.13
264 0.17
265 0.21
266 0.27
267 0.36
268 0.44
269 0.53
270 0.61
271 0.67
272 0.73
273 0.8
274 0.82
275 0.79
276 0.81
277 0.82