Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LV00

Protein Details
Accession A0A3N4LV00    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
154-190AEKKDHVSKLKRDEKERRMKMKKQHSNKKSSRRPKGDBasic
NLS Segment(s)
PositionSequence
159-190HVSKLKRDEKERRMKMKKQHSNKKSSRRPKGD
Subcellular Location(s) mito 17.5, mito_nucl 14, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MSVRGLARCIPLRGSSIAGAQRFFASNTPDQGFDEEGLKEARKWLSSFTPDSIPREYCDVSFSRSSGPGGQNVNKLNTKATLRFNLNKASNHIPSLIMIRIRSDPSIGRYRTIHDELLIQSDTYRKQLDNELECYRKLYQSIVEAAALPGETSAEKKDHVSKLKRDEKERRMKMKKQHSNKKSSRRPKGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.24
3 0.26
4 0.29
5 0.28
6 0.26
7 0.23
8 0.23
9 0.22
10 0.22
11 0.19
12 0.19
13 0.21
14 0.25
15 0.26
16 0.25
17 0.25
18 0.26
19 0.25
20 0.2
21 0.19
22 0.14
23 0.14
24 0.15
25 0.15
26 0.13
27 0.16
28 0.18
29 0.18
30 0.18
31 0.21
32 0.25
33 0.29
34 0.32
35 0.3
36 0.34
37 0.34
38 0.37
39 0.37
40 0.31
41 0.28
42 0.29
43 0.27
44 0.21
45 0.22
46 0.19
47 0.2
48 0.2
49 0.19
50 0.17
51 0.17
52 0.18
53 0.19
54 0.19
55 0.2
56 0.23
57 0.25
58 0.28
59 0.28
60 0.31
61 0.28
62 0.27
63 0.24
64 0.23
65 0.23
66 0.23
67 0.25
68 0.26
69 0.29
70 0.33
71 0.34
72 0.37
73 0.38
74 0.35
75 0.35
76 0.35
77 0.32
78 0.28
79 0.27
80 0.2
81 0.17
82 0.18
83 0.15
84 0.11
85 0.1
86 0.11
87 0.12
88 0.13
89 0.12
90 0.12
91 0.11
92 0.15
93 0.23
94 0.22
95 0.23
96 0.22
97 0.25
98 0.3
99 0.31
100 0.26
101 0.19
102 0.21
103 0.19
104 0.22
105 0.19
106 0.13
107 0.11
108 0.13
109 0.14
110 0.14
111 0.15
112 0.12
113 0.14
114 0.2
115 0.27
116 0.28
117 0.32
118 0.35
119 0.35
120 0.35
121 0.36
122 0.32
123 0.26
124 0.23
125 0.2
126 0.17
127 0.18
128 0.21
129 0.19
130 0.18
131 0.17
132 0.16
133 0.14
134 0.12
135 0.08
136 0.05
137 0.05
138 0.05
139 0.06
140 0.09
141 0.1
142 0.11
143 0.14
144 0.22
145 0.29
146 0.38
147 0.45
148 0.51
149 0.61
150 0.7
151 0.74
152 0.76
153 0.79
154 0.81
155 0.84
156 0.86
157 0.86
158 0.86
159 0.87
160 0.88
161 0.88
162 0.88
163 0.88
164 0.89
165 0.88
166 0.89
167 0.91
168 0.92
169 0.92
170 0.92