Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LY64

Protein Details
Accession A0A3N4LY64    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
50-75ATWSWPKRFAARQHRRRGRLTRQMRIHydrophilic
187-218KENATRERIEREKREKKERKRVWVHLPNKQIYBasic
NLS Segment(s)
PositionSequence
60-68ARQHRRRGR
194-207RIEREKREKKERKR
Subcellular Location(s) nucl 11, mito 9, cyto 3, pero 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001063  Ribosomal_L22  
IPR036394  Ribosomal_L22/L17_sf  
IPR005727  Ribosomal_L22_bac/chlpt-type  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00237  Ribosomal_L22  
CDD cd00336  Ribosomal_L22  
Amino Acid Sequences MLPPVFEKGGLASTSVFGSEPTEEASASSTSIRAITTQEYLSFVDPTRSATWSWPKRFAARQHRRRGRLTRQMRILQTERSHTAKSHWIKTSVKKLAPLARQISGLPLNDAIVQMRFSPKKASTDVMNLLGEARMEAMVRRGMTDGEMFVSQAWVGRGTYEKEISHRARGRIDMLRKPYTSITVVLKENATRERIEREKREKKERKRVWVHLPNKQIYGQQQYYQW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.08
5 0.1
6 0.1
7 0.1
8 0.11
9 0.12
10 0.11
11 0.11
12 0.14
13 0.12
14 0.12
15 0.12
16 0.09
17 0.09
18 0.1
19 0.1
20 0.09
21 0.1
22 0.12
23 0.14
24 0.15
25 0.15
26 0.16
27 0.17
28 0.18
29 0.17
30 0.15
31 0.15
32 0.15
33 0.18
34 0.18
35 0.18
36 0.18
37 0.22
38 0.33
39 0.39
40 0.44
41 0.47
42 0.48
43 0.53
44 0.59
45 0.63
46 0.64
47 0.66
48 0.71
49 0.75
50 0.82
51 0.82
52 0.84
53 0.83
54 0.82
55 0.82
56 0.8
57 0.77
58 0.76
59 0.76
60 0.69
61 0.66
62 0.58
63 0.53
64 0.47
65 0.43
66 0.38
67 0.35
68 0.34
69 0.28
70 0.28
71 0.31
72 0.34
73 0.36
74 0.35
75 0.37
76 0.41
77 0.46
78 0.53
79 0.51
80 0.47
81 0.43
82 0.45
83 0.47
84 0.46
85 0.45
86 0.38
87 0.33
88 0.32
89 0.29
90 0.28
91 0.23
92 0.19
93 0.14
94 0.11
95 0.1
96 0.1
97 0.1
98 0.08
99 0.06
100 0.06
101 0.06
102 0.11
103 0.11
104 0.11
105 0.15
106 0.17
107 0.2
108 0.21
109 0.22
110 0.2
111 0.23
112 0.24
113 0.23
114 0.21
115 0.17
116 0.16
117 0.14
118 0.12
119 0.08
120 0.06
121 0.04
122 0.04
123 0.04
124 0.06
125 0.08
126 0.08
127 0.09
128 0.09
129 0.09
130 0.1
131 0.1
132 0.08
133 0.08
134 0.08
135 0.07
136 0.07
137 0.07
138 0.06
139 0.07
140 0.07
141 0.06
142 0.06
143 0.07
144 0.09
145 0.12
146 0.15
147 0.17
148 0.17
149 0.19
150 0.27
151 0.29
152 0.36
153 0.39
154 0.39
155 0.39
156 0.41
157 0.43
158 0.43
159 0.48
160 0.45
161 0.47
162 0.5
163 0.47
164 0.48
165 0.44
166 0.39
167 0.34
168 0.3
169 0.28
170 0.27
171 0.28
172 0.27
173 0.27
174 0.24
175 0.26
176 0.27
177 0.24
178 0.22
179 0.23
180 0.3
181 0.37
182 0.45
183 0.52
184 0.59
185 0.67
186 0.75
187 0.84
188 0.86
189 0.88
190 0.9
191 0.9
192 0.9
193 0.9
194 0.9
195 0.9
196 0.9
197 0.87
198 0.85
199 0.84
200 0.77
201 0.7
202 0.63
203 0.57
204 0.53
205 0.54
206 0.49