Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LJQ9

Protein Details
Accession A0A3N4LJQ9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-66GRPAKRYYPFRNKRKTAVRRTSTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 7extr 7, mito 4, E.R. 3, cyto_mito 3, cyto 2, golg 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045293  Complex1_LYR_LYRM2  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20262  Complex1_LYR_LYRM2  
Amino Acid Sequences MFLKENCIFLISAVFYAASFVVKLFNDLIGVESASRETPLSDFGRPAKRYYPFRNKRKTAVRRTSTPKCSDLGSLPMSIFLIRAPLTCSRVGIGAPYASYATAIKPGGIPTLKQFILRSRVLGLYRNVLRTLRNINPSLRTELKTYARGEFERNRFVAEESHVRYLLSLGEKELGQMKRYIMGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.1
4 0.1
5 0.07
6 0.06
7 0.06
8 0.09
9 0.09
10 0.11
11 0.11
12 0.11
13 0.11
14 0.11
15 0.12
16 0.09
17 0.1
18 0.08
19 0.08
20 0.08
21 0.08
22 0.09
23 0.07
24 0.08
25 0.08
26 0.13
27 0.16
28 0.16
29 0.18
30 0.24
31 0.33
32 0.33
33 0.36
34 0.37
35 0.42
36 0.49
37 0.57
38 0.62
39 0.63
40 0.72
41 0.8
42 0.78
43 0.79
44 0.82
45 0.82
46 0.82
47 0.82
48 0.78
49 0.75
50 0.79
51 0.8
52 0.76
53 0.7
54 0.61
55 0.51
56 0.46
57 0.4
58 0.33
59 0.28
60 0.22
61 0.18
62 0.16
63 0.15
64 0.14
65 0.12
66 0.1
67 0.06
68 0.06
69 0.05
70 0.06
71 0.08
72 0.1
73 0.13
74 0.13
75 0.13
76 0.11
77 0.12
78 0.11
79 0.1
80 0.08
81 0.06
82 0.05
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.07
90 0.07
91 0.07
92 0.08
93 0.08
94 0.11
95 0.11
96 0.11
97 0.11
98 0.16
99 0.16
100 0.17
101 0.18
102 0.19
103 0.25
104 0.25
105 0.23
106 0.2
107 0.23
108 0.23
109 0.26
110 0.23
111 0.24
112 0.26
113 0.26
114 0.26
115 0.24
116 0.24
117 0.24
118 0.29
119 0.28
120 0.31
121 0.33
122 0.34
123 0.38
124 0.4
125 0.42
126 0.4
127 0.36
128 0.33
129 0.37
130 0.39
131 0.39
132 0.38
133 0.36
134 0.36
135 0.36
136 0.4
137 0.42
138 0.43
139 0.44
140 0.43
141 0.41
142 0.37
143 0.37
144 0.34
145 0.3
146 0.32
147 0.3
148 0.33
149 0.31
150 0.3
151 0.29
152 0.26
153 0.25
154 0.21
155 0.18
156 0.15
157 0.17
158 0.17
159 0.18
160 0.25
161 0.23
162 0.21
163 0.24
164 0.23