Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LUF2

Protein Details
Accession A0A3N4LUF2   
Localization Confidence Low
Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
263-282QGPGGKKYRVRKFEYRNLAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 11, nucl 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029069  HotDog_dom_sf  
Amino Acid Sequences MTPPRFLPLRCLSTTITTPTPESLLGRRYRPLPDILSPTNAHLLTLSLAPYLTPTQPPPSSIRTSGELDPGFYLAYFPPLFLHERDVMPDGSDATQSPGPVGDWPRRMWAGGEVYIGKGGEGGGKLMIGKGAVCEESVVRVNRKGGKSGEKVFVWFERKYFGGKPAVREVRCLAFMKHKEVDGTKVTETKVVKFPNPPDFSLTFTPTPTLLLRFSALTFNAHKIHFDPIFSAQVENYRAPLCHGPLSQVILLELLRLNLPPPQGPGGKKYRVRKFEYRNLAAMYVGEKYTICGRLKREHGEVQFGEEVGEEVGEGLVYELWAETPKGGLSVKATATVAVVNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.36
4 0.31
5 0.31
6 0.29
7 0.28
8 0.24
9 0.24
10 0.24
11 0.28
12 0.32
13 0.34
14 0.37
15 0.39
16 0.42
17 0.43
18 0.44
19 0.41
20 0.42
21 0.46
22 0.44
23 0.45
24 0.41
25 0.4
26 0.4
27 0.35
28 0.28
29 0.21
30 0.19
31 0.15
32 0.16
33 0.14
34 0.08
35 0.08
36 0.08
37 0.1
38 0.12
39 0.13
40 0.14
41 0.16
42 0.23
43 0.24
44 0.27
45 0.3
46 0.33
47 0.36
48 0.36
49 0.37
50 0.34
51 0.37
52 0.36
53 0.38
54 0.32
55 0.28
56 0.26
57 0.23
58 0.19
59 0.15
60 0.14
61 0.07
62 0.12
63 0.11
64 0.1
65 0.11
66 0.13
67 0.16
68 0.15
69 0.2
70 0.18
71 0.18
72 0.2
73 0.22
74 0.2
75 0.18
76 0.18
77 0.15
78 0.12
79 0.13
80 0.11
81 0.12
82 0.13
83 0.11
84 0.11
85 0.1
86 0.1
87 0.13
88 0.17
89 0.2
90 0.22
91 0.23
92 0.27
93 0.27
94 0.27
95 0.24
96 0.24
97 0.21
98 0.19
99 0.2
100 0.17
101 0.16
102 0.17
103 0.16
104 0.11
105 0.07
106 0.06
107 0.06
108 0.06
109 0.06
110 0.05
111 0.06
112 0.06
113 0.06
114 0.06
115 0.04
116 0.04
117 0.04
118 0.05
119 0.05
120 0.05
121 0.06
122 0.05
123 0.07
124 0.11
125 0.13
126 0.14
127 0.15
128 0.19
129 0.25
130 0.26
131 0.28
132 0.28
133 0.34
134 0.37
135 0.4
136 0.41
137 0.35
138 0.35
139 0.32
140 0.33
141 0.3
142 0.25
143 0.21
144 0.18
145 0.18
146 0.2
147 0.2
148 0.2
149 0.24
150 0.25
151 0.28
152 0.35
153 0.41
154 0.38
155 0.38
156 0.36
157 0.29
158 0.3
159 0.28
160 0.21
161 0.22
162 0.24
163 0.27
164 0.27
165 0.25
166 0.24
167 0.24
168 0.27
169 0.21
170 0.22
171 0.18
172 0.19
173 0.18
174 0.21
175 0.21
176 0.21
177 0.24
178 0.24
179 0.25
180 0.28
181 0.32
182 0.37
183 0.4
184 0.37
185 0.36
186 0.35
187 0.36
188 0.34
189 0.33
190 0.24
191 0.21
192 0.21
193 0.17
194 0.18
195 0.14
196 0.14
197 0.1
198 0.1
199 0.11
200 0.11
201 0.12
202 0.11
203 0.11
204 0.12
205 0.13
206 0.16
207 0.18
208 0.18
209 0.18
210 0.17
211 0.22
212 0.2
213 0.19
214 0.17
215 0.17
216 0.2
217 0.19
218 0.19
219 0.14
220 0.17
221 0.19
222 0.18
223 0.17
224 0.15
225 0.14
226 0.17
227 0.19
228 0.18
229 0.19
230 0.19
231 0.2
232 0.21
233 0.23
234 0.21
235 0.18
236 0.16
237 0.13
238 0.12
239 0.11
240 0.09
241 0.07
242 0.07
243 0.07
244 0.07
245 0.09
246 0.11
247 0.11
248 0.13
249 0.17
250 0.21
251 0.23
252 0.3
253 0.35
254 0.43
255 0.49
256 0.56
257 0.61
258 0.65
259 0.72
260 0.75
261 0.76
262 0.78
263 0.81
264 0.75
265 0.69
266 0.63
267 0.55
268 0.45
269 0.36
270 0.28
271 0.19
272 0.15
273 0.12
274 0.1
275 0.11
276 0.15
277 0.21
278 0.22
279 0.25
280 0.31
281 0.39
282 0.46
283 0.5
284 0.51
285 0.53
286 0.53
287 0.57
288 0.52
289 0.49
290 0.43
291 0.37
292 0.31
293 0.23
294 0.21
295 0.12
296 0.12
297 0.06
298 0.05
299 0.05
300 0.04
301 0.04
302 0.04
303 0.04
304 0.04
305 0.04
306 0.04
307 0.05
308 0.07
309 0.07
310 0.07
311 0.08
312 0.08
313 0.11
314 0.11
315 0.12
316 0.14
317 0.19
318 0.19
319 0.21
320 0.21
321 0.19
322 0.19