Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L917

Protein Details
Accession A0A3N4L917   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
42-63SFSPARSKKERERGRKELNKSKBasic
NLS Segment(s)
PositionSequence
23-61RIEKKVGLKKRVEENPLRISFSPARSKKERERGRKELNK
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MEILNSIETGDSESAESGRDKDRIEKKVGLKKRVEENPLRISFSPARSKKERERGRKELNKSKYAIPELSAEQVESIARKKVEGGDKIAKGKEEENEEEEDEEMEEEEEGEETEAKWNGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.12
4 0.11
5 0.15
6 0.17
7 0.18
8 0.27
9 0.35
10 0.39
11 0.44
12 0.48
13 0.53
14 0.6
15 0.67
16 0.66
17 0.62
18 0.63
19 0.66
20 0.66
21 0.65
22 0.61
23 0.6
24 0.61
25 0.57
26 0.55
27 0.46
28 0.44
29 0.41
30 0.4
31 0.44
32 0.38
33 0.43
34 0.44
35 0.51
36 0.54
37 0.61
38 0.65
39 0.66
40 0.71
41 0.75
42 0.8
43 0.82
44 0.81
45 0.8
46 0.76
47 0.7
48 0.63
49 0.57
50 0.51
51 0.46
52 0.38
53 0.29
54 0.26
55 0.22
56 0.22
57 0.18
58 0.13
59 0.11
60 0.1
61 0.09
62 0.08
63 0.09
64 0.1
65 0.1
66 0.1
67 0.11
68 0.17
69 0.24
70 0.25
71 0.31
72 0.35
73 0.38
74 0.42
75 0.42
76 0.37
77 0.32
78 0.32
79 0.29
80 0.28
81 0.28
82 0.27
83 0.29
84 0.28
85 0.27
86 0.25
87 0.21
88 0.15
89 0.12
90 0.1
91 0.08
92 0.07
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.07
99 0.07
100 0.12