Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LVY5

Protein Details
Accession A0A3N4LVY5    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-72AYCTATRARKKKADKMNVCTVYRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 4, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MAPFGPWLTISSQLVLCSQRHQFTLISLKPRSKASRPISPVEKSNVSHVAYCTATRARKKKADKMNVCTVYRYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.19
4 0.19
5 0.23
6 0.23
7 0.23
8 0.24
9 0.22
10 0.23
11 0.31
12 0.29
13 0.32
14 0.32
15 0.34
16 0.34
17 0.39
18 0.4
19 0.35
20 0.42
21 0.41
22 0.47
23 0.49
24 0.51
25 0.51
26 0.48
27 0.47
28 0.41
29 0.38
30 0.3
31 0.3
32 0.3
33 0.26
34 0.25
35 0.23
36 0.22
37 0.2
38 0.19
39 0.19
40 0.2
41 0.25
42 0.32
43 0.4
44 0.45
45 0.54
46 0.62
47 0.69
48 0.74
49 0.79
50 0.8
51 0.8
52 0.83
53 0.81
54 0.74