Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LVL5

Protein Details
Accession A0A3N4LVL5   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-94MHYTPPPPHSMQKRKRRRQYPISRPRIHRQNPNELDHydrophilic
NLS Segment(s)
PositionSequence
71-79KRKRRRQYP
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPKPHLHPHPLPHPHSHPSLSYKEHPQTNESLSSCPPSPSTLFVSARNISVSTPYSPRMHYTPPPPHSMQKRKRRRQYPISRPRIHRQNPNELDTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.59
3 0.53
4 0.46
5 0.43
6 0.44
7 0.42
8 0.41
9 0.44
10 0.46
11 0.48
12 0.46
13 0.43
14 0.41
15 0.38
16 0.39
17 0.32
18 0.28
19 0.24
20 0.26
21 0.24
22 0.21
23 0.19
24 0.16
25 0.16
26 0.17
27 0.19
28 0.22
29 0.23
30 0.23
31 0.27
32 0.25
33 0.24
34 0.22
35 0.19
36 0.13
37 0.13
38 0.13
39 0.11
40 0.12
41 0.15
42 0.16
43 0.16
44 0.19
45 0.2
46 0.23
47 0.26
48 0.33
49 0.4
50 0.42
51 0.47
52 0.47
53 0.52
54 0.58
55 0.64
56 0.65
57 0.67
58 0.75
59 0.8
60 0.88
61 0.9
62 0.9
63 0.9
64 0.92
65 0.92
66 0.92
67 0.92
68 0.91
69 0.88
70 0.88
71 0.88
72 0.84
73 0.83
74 0.8
75 0.8
76 0.77