Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4M052

Protein Details
Accession A0A3N4M052    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-33YECFFRRPRMRGKRDNKFFDNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, golg 6, extr 5, plas 2, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045341  DUF6532  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20149  DUF6532  
Amino Acid Sequences HRFWAAQIVTIIYECFFRRPRMRGKRDNKFFDNINAVFICLVAAAIQHCLKELKTGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.14
3 0.16
4 0.23
5 0.28
6 0.34
7 0.45
8 0.54
9 0.62
10 0.68
11 0.75
12 0.8
13 0.83
14 0.84
15 0.76
16 0.68
17 0.6
18 0.52
19 0.48
20 0.38
21 0.31
22 0.23
23 0.21
24 0.17
25 0.16
26 0.12
27 0.06
28 0.06
29 0.03
30 0.04
31 0.04
32 0.08
33 0.09
34 0.09
35 0.1
36 0.12
37 0.12