Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4M3W7

Protein Details
Accession A0A3N4M3W7    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
48-67NKSRGGRPPKLSKRDRRAISBasic
NLS Segment(s)
PositionSequence
49-74KSRGGRPPKLSKRDRRAISRYIKRNR
Subcellular Location(s) nucl 6, mito 6, plas 6, mito_nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANAEKGAILVLHLLFYSFTTISLIVGRPYMTVKNFITRTLERQSMDNKSRGGRPPKLSKRDRRAISRYIKRNRTASREEVRQHCAPHVSLKTIDRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.1
5 0.08
6 0.08
7 0.09
8 0.09
9 0.09
10 0.11
11 0.11
12 0.09
13 0.09
14 0.09
15 0.09
16 0.1
17 0.13
18 0.12
19 0.16
20 0.17
21 0.23
22 0.24
23 0.24
24 0.28
25 0.26
26 0.3
27 0.3
28 0.32
29 0.26
30 0.28
31 0.31
32 0.33
33 0.35
34 0.32
35 0.3
36 0.28
37 0.32
38 0.37
39 0.4
40 0.39
41 0.43
42 0.51
43 0.59
44 0.67
45 0.72
46 0.75
47 0.77
48 0.8
49 0.79
50 0.77
51 0.73
52 0.73
53 0.74
54 0.74
55 0.74
56 0.75
57 0.76
58 0.73
59 0.76
60 0.74
61 0.71
62 0.68
63 0.67
64 0.65
65 0.66
66 0.67
67 0.64
68 0.64
69 0.59
70 0.55
71 0.5
72 0.45
73 0.39
74 0.4
75 0.38
76 0.36
77 0.36