Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WQW6

Protein Details
Accession K1WQW6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
24-54VYFDYKRRNDPQFRKQLKKDSKRQAKAAKEEHydrophilic
NLS Segment(s)
PositionSequence
37-50RKQLKKDSKRQAKA
Subcellular Location(s) nucl 11, cyto 10.5, cyto_mito 7.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002056  MAS20  
IPR023392  Tom20_dom_sf  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0006605  P:protein targeting  
KEGG mbe:MBM_01982  -  
Pfam View protein in Pfam  
PF02064  MAS20  
Amino Acid Sequences MVQTSTIVAAAVGTFATGFVAYAVYFDYKRRNDPQFRKQLKKDSKRQAKAAKEEAEAHTLRQRQAIREALEEAKEEGFPSDLEDREAYFLQEVARAEGLAGEGTDNIEAALCFYKALKVYPTPGDLIAIYDKTGNAQGSPRHTGRDDCGRLRTQSWSFYKWPRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.04
9 0.05
10 0.06
11 0.08
12 0.09
13 0.11
14 0.2
15 0.22
16 0.29
17 0.36
18 0.45
19 0.53
20 0.63
21 0.71
22 0.74
23 0.8
24 0.83
25 0.82
26 0.84
27 0.84
28 0.85
29 0.84
30 0.84
31 0.86
32 0.83
33 0.85
34 0.83
35 0.8
36 0.77
37 0.75
38 0.68
39 0.59
40 0.56
41 0.49
42 0.45
43 0.37
44 0.31
45 0.28
46 0.26
47 0.25
48 0.27
49 0.26
50 0.23
51 0.28
52 0.32
53 0.28
54 0.27
55 0.29
56 0.24
57 0.23
58 0.22
59 0.17
60 0.13
61 0.11
62 0.1
63 0.08
64 0.07
65 0.06
66 0.08
67 0.09
68 0.09
69 0.1
70 0.1
71 0.1
72 0.11
73 0.11
74 0.09
75 0.07
76 0.08
77 0.07
78 0.09
79 0.09
80 0.08
81 0.08
82 0.08
83 0.07
84 0.07
85 0.07
86 0.05
87 0.04
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.03
94 0.03
95 0.03
96 0.04
97 0.05
98 0.05
99 0.05
100 0.06
101 0.08
102 0.09
103 0.1
104 0.12
105 0.13
106 0.17
107 0.2
108 0.21
109 0.2
110 0.2
111 0.19
112 0.16
113 0.17
114 0.15
115 0.13
116 0.11
117 0.11
118 0.11
119 0.11
120 0.14
121 0.12
122 0.11
123 0.15
124 0.19
125 0.24
126 0.31
127 0.31
128 0.32
129 0.34
130 0.36
131 0.37
132 0.44
133 0.45
134 0.43
135 0.48
136 0.48
137 0.49
138 0.48
139 0.5
140 0.43
141 0.46
142 0.46
143 0.46
144 0.48