Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LHQ8

Protein Details
Accession A0A3N4LHQ8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
61-83AEEQFRRGKRRKKEEEADKEEREBasic
91-110KEEKERKEKRSIREERREEEBasic
NLS Segment(s)
PositionSequence
31-116RGAKKAKKAMKAKEEAERQDKRKKKEDEAEAEEQFRRGKRRKKEEEADKEEREMREEEEEKEEKERKEKRSIREERREEEEEKVEK
Subcellular Location(s) nucl 11, mito 7.5, cyto_mito 7, cyto 5.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVWDLFVSTMSGGTISLVGLVSTLVWYLWERGAKKAKKAMKAKEEAERQDKRKKKEDEAEAEEQFRRGKRRKKEEEADKEEREMREEEEEKEEKERKEKRSIREERREEEEEKVEKERKQEEDEGRPARAGGEGTTGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.03
12 0.04
13 0.06
14 0.07
15 0.1
16 0.15
17 0.16
18 0.24
19 0.34
20 0.36
21 0.41
22 0.48
23 0.51
24 0.56
25 0.64
26 0.66
27 0.65
28 0.68
29 0.66
30 0.66
31 0.67
32 0.63
33 0.63
34 0.61
35 0.58
36 0.61
37 0.64
38 0.62
39 0.65
40 0.65
41 0.64
42 0.66
43 0.68
44 0.67
45 0.67
46 0.66
47 0.57
48 0.53
49 0.45
50 0.37
51 0.31
52 0.25
53 0.25
54 0.28
55 0.35
56 0.43
57 0.54
58 0.63
59 0.69
60 0.77
61 0.8
62 0.82
63 0.83
64 0.8
65 0.7
66 0.63
67 0.58
68 0.48
69 0.4
70 0.3
71 0.23
72 0.22
73 0.23
74 0.22
75 0.25
76 0.26
77 0.24
78 0.29
79 0.33
80 0.28
81 0.36
82 0.42
83 0.42
84 0.51
85 0.57
86 0.6
87 0.66
88 0.75
89 0.76
90 0.8
91 0.81
92 0.75
93 0.75
94 0.71
95 0.62
96 0.57
97 0.54
98 0.46
99 0.42
100 0.44
101 0.42
102 0.4
103 0.44
104 0.46
105 0.43
106 0.46
107 0.52
108 0.53
109 0.57
110 0.64
111 0.61
112 0.56
113 0.51
114 0.45
115 0.36
116 0.31
117 0.23
118 0.14