Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WPD4

Protein Details
Accession K1WPD4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-55VPETLLKKRKSQEKAREERTAELEKKKKAAKEKRGVIFKRBasic
NLS Segment(s)
PositionSequence
22-58KKRKSQEKAREERTAELEKKKKAAKEKRGVIFKRAEK
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR016082  Ribosomal_L30_ferredoxin-like  
IPR012988  Ribosomal_L30_N  
IPR039699  Ribosomal_L7/L30  
IPR005998  Ribosomal_L7_euk  
IPR035808  Ribosomal_L7_euk_arc  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG mbe:MBM_07042  -  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
PF08079  Ribosomal_L30_N  
CDD cd01657  Ribosomal_L7_archeal_euk  
Amino Acid Sequences MPSSKSTAPTLDQILVPETLLKKRKSQEKAREERTAELEKKKKAAKEKRGVIFKRAEKYVKEYRDQEREKIRLQRLAKQEGNFYIPAEDKLVFVVRIKGINKIAPKPRKILQLLRLLQINNGVFVRMTKATLEMLKVVEPWIAYGYPNLKTVRELIYKRGYGKVNKQRIALTDNSIIEENLGKYGIVCMEDLIHEIFTVGPNFKQAANFLWPFKLSNPTGGFRTRKFRHYVEGGDLGNREEKINALVRQMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.19
4 0.19
5 0.19
6 0.24
7 0.31
8 0.32
9 0.37
10 0.45
11 0.55
12 0.61
13 0.69
14 0.72
15 0.76
16 0.84
17 0.84
18 0.84
19 0.77
20 0.72
21 0.68
22 0.66
23 0.61
24 0.6
25 0.6
26 0.55
27 0.59
28 0.6
29 0.6
30 0.62
31 0.66
32 0.68
33 0.71
34 0.76
35 0.78
36 0.83
37 0.79
38 0.75
39 0.73
40 0.68
41 0.64
42 0.6
43 0.56
44 0.48
45 0.52
46 0.55
47 0.51
48 0.51
49 0.51
50 0.53
51 0.59
52 0.6
53 0.6
54 0.59
55 0.59
56 0.59
57 0.62
58 0.59
59 0.56
60 0.56
61 0.57
62 0.55
63 0.59
64 0.57
65 0.49
66 0.48
67 0.42
68 0.42
69 0.35
70 0.28
71 0.21
72 0.17
73 0.17
74 0.15
75 0.13
76 0.1
77 0.11
78 0.11
79 0.1
80 0.1
81 0.12
82 0.11
83 0.15
84 0.15
85 0.18
86 0.19
87 0.22
88 0.25
89 0.29
90 0.38
91 0.41
92 0.43
93 0.43
94 0.46
95 0.5
96 0.5
97 0.5
98 0.48
99 0.51
100 0.5
101 0.47
102 0.45
103 0.37
104 0.33
105 0.3
106 0.23
107 0.14
108 0.12
109 0.11
110 0.08
111 0.08
112 0.11
113 0.07
114 0.08
115 0.07
116 0.07
117 0.08
118 0.09
119 0.1
120 0.08
121 0.08
122 0.08
123 0.08
124 0.08
125 0.08
126 0.07
127 0.06
128 0.07
129 0.06
130 0.06
131 0.08
132 0.1
133 0.11
134 0.15
135 0.15
136 0.14
137 0.15
138 0.17
139 0.21
140 0.25
141 0.25
142 0.27
143 0.33
144 0.35
145 0.36
146 0.39
147 0.38
148 0.36
149 0.46
150 0.5
151 0.53
152 0.54
153 0.54
154 0.51
155 0.49
156 0.48
157 0.4
158 0.33
159 0.29
160 0.26
161 0.25
162 0.24
163 0.21
164 0.17
165 0.16
166 0.13
167 0.09
168 0.09
169 0.07
170 0.07
171 0.08
172 0.08
173 0.07
174 0.07
175 0.06
176 0.07
177 0.07
178 0.09
179 0.08
180 0.07
181 0.06
182 0.07
183 0.07
184 0.08
185 0.1
186 0.09
187 0.09
188 0.11
189 0.12
190 0.13
191 0.14
192 0.14
193 0.16
194 0.21
195 0.24
196 0.23
197 0.24
198 0.24
199 0.25
200 0.26
201 0.3
202 0.24
203 0.29
204 0.32
205 0.32
206 0.35
207 0.41
208 0.44
209 0.41
210 0.51
211 0.48
212 0.51
213 0.54
214 0.54
215 0.55
216 0.56
217 0.56
218 0.51
219 0.53
220 0.47
221 0.43
222 0.41
223 0.34
224 0.31
225 0.27
226 0.22
227 0.16
228 0.17
229 0.19
230 0.25
231 0.25