Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L5A5

Protein Details
Accession A0A3N4L5A5   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-28KEICSMKQSKIVKRNRKRMSKFAKMIIHydrophilic
NLS Segment(s)
PositionSequence
14-19KRNRKR
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MKEICSMKQSKIVKRNRKRMSKFAKMIIGAQGNFGHFGLQSQEDMLWLSRQYDTVMMHRNGVAHEITGESTYHAFQHLKAREKAIYGMLFKHYFLCPMEKWKTEATDEQKNRIISNCTDEELEEYLQGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.85
3 0.86
4 0.9
5 0.87
6 0.88
7 0.88
8 0.87
9 0.82
10 0.78
11 0.74
12 0.63
13 0.58
14 0.52
15 0.46
16 0.35
17 0.31
18 0.26
19 0.2
20 0.2
21 0.18
22 0.13
23 0.08
24 0.09
25 0.09
26 0.09
27 0.09
28 0.08
29 0.08
30 0.08
31 0.09
32 0.09
33 0.08
34 0.07
35 0.08
36 0.08
37 0.09
38 0.09
39 0.1
40 0.11
41 0.14
42 0.2
43 0.19
44 0.2
45 0.2
46 0.2
47 0.18
48 0.18
49 0.14
50 0.07
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.06
58 0.06
59 0.06
60 0.08
61 0.08
62 0.09
63 0.18
64 0.23
65 0.28
66 0.3
67 0.32
68 0.32
69 0.32
70 0.32
71 0.27
72 0.24
73 0.19
74 0.2
75 0.21
76 0.21
77 0.2
78 0.21
79 0.17
80 0.17
81 0.17
82 0.2
83 0.17
84 0.25
85 0.3
86 0.3
87 0.33
88 0.34
89 0.35
90 0.34
91 0.41
92 0.39
93 0.44
94 0.45
95 0.48
96 0.5
97 0.48
98 0.46
99 0.42
100 0.41
101 0.32
102 0.37
103 0.33
104 0.29
105 0.29
106 0.28
107 0.27
108 0.25
109 0.23