Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LKA7

Protein Details
Accession A0A3N4LKA7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-29ASASASPPTDRRRRRRGLKNKRDGDELHydrophilic
NLS Segment(s)
PositionSequence
13-24RRRRRRGLKNKR
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MSASASASPPTDRRRRRRGLKNKRDGDELAGDEEEDGMELDEDDASHTENKLSGSEEEEEGEWGGPDSSSESEDIGASTRVFCTYCPPPMCTKERRCDGCCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.75
3 0.82
4 0.87
5 0.9
6 0.91
7 0.92
8 0.93
9 0.92
10 0.85
11 0.79
12 0.69
13 0.61
14 0.54
15 0.44
16 0.35
17 0.26
18 0.22
19 0.17
20 0.16
21 0.11
22 0.06
23 0.05
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.04
32 0.05
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.08
40 0.08
41 0.1
42 0.11
43 0.11
44 0.11
45 0.1
46 0.1
47 0.09
48 0.08
49 0.06
50 0.05
51 0.05
52 0.04
53 0.04
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.08
65 0.08
66 0.08
67 0.09
68 0.09
69 0.09
70 0.15
71 0.18
72 0.27
73 0.29
74 0.32
75 0.38
76 0.45
77 0.52
78 0.56
79 0.6
80 0.62
81 0.69
82 0.74