Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1X0Q0

Protein Details
Accession K1X0Q0   
Localization Confidence High
Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
100-125VVAAEPEKKERKKRLHDPNAPKRPLTBasic
259-286EKEPTPPPKTPKAKNTRRSKGGKNSTPAHydrophilic
308-360IAPPKPAEKEKSPEKKRKRGSKKEEEKVVVEEPAAETPKSAPKPRKKKTRSDSBasic
NLS Segment(s)
PositionSequence
107-119KKERKKRLHDPNA
265-282PPKTPKAKNTRRSKGGKN
310-357PPKPAEKEKSPEKKRKRGSKKEEEKVVVEEPAAETPKSAPKPRKKKTR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.833, mito_nucl 12.166, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG mbe:MBM_03545  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MGRAKKSEEKPKESKDGPTLQIDVDHFVRTRDSVVSGLATLQDAIQTLSSAYIKHTNTVLVGHGAGLDVDTTLAKLVENPLLKDMEESADRAASPAKSVVVAAEPEKKERKKRLHDPNAPKRPLTPFFLYMKTARPIIASDLGPDAAKGAVSTEGTKRWSVMDAHQKYLWGNVYKDNLRLYNARMHAYKQGGNVAAKDMTDAEALAYAEEHNIGINPSDVPSLDPAAAVPEEDAEAEAEAEAEAEAETGADADADDEPEKEPTPPPKTPKAKNTRRSKGGKNSTPAAAAAAAAASPEAIMPPPSASSIAPPKPAEKEKSPEKKRKRGSKKEEEKVVVEEPAAETPKSAPKPRKKKTRSDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.71
3 0.69
4 0.64
5 0.59
6 0.53
7 0.43
8 0.44
9 0.37
10 0.33
11 0.26
12 0.25
13 0.21
14 0.2
15 0.21
16 0.18
17 0.19
18 0.17
19 0.17
20 0.15
21 0.16
22 0.16
23 0.14
24 0.14
25 0.12
26 0.11
27 0.09
28 0.08
29 0.08
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.09
36 0.09
37 0.09
38 0.12
39 0.18
40 0.19
41 0.21
42 0.21
43 0.2
44 0.2
45 0.21
46 0.19
47 0.13
48 0.13
49 0.11
50 0.1
51 0.09
52 0.08
53 0.07
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.06
63 0.08
64 0.13
65 0.15
66 0.16
67 0.18
68 0.19
69 0.19
70 0.18
71 0.17
72 0.14
73 0.13
74 0.14
75 0.12
76 0.12
77 0.12
78 0.12
79 0.13
80 0.11
81 0.11
82 0.11
83 0.11
84 0.1
85 0.1
86 0.1
87 0.09
88 0.1
89 0.12
90 0.18
91 0.19
92 0.24
93 0.32
94 0.38
95 0.45
96 0.54
97 0.62
98 0.64
99 0.74
100 0.8
101 0.83
102 0.88
103 0.9
104 0.91
105 0.92
106 0.83
107 0.73
108 0.65
109 0.61
110 0.54
111 0.49
112 0.42
113 0.36
114 0.37
115 0.38
116 0.37
117 0.32
118 0.32
119 0.28
120 0.25
121 0.2
122 0.18
123 0.16
124 0.17
125 0.19
126 0.15
127 0.14
128 0.14
129 0.14
130 0.13
131 0.12
132 0.09
133 0.06
134 0.06
135 0.04
136 0.04
137 0.05
138 0.06
139 0.08
140 0.09
141 0.11
142 0.13
143 0.13
144 0.13
145 0.12
146 0.14
147 0.14
148 0.19
149 0.28
150 0.28
151 0.3
152 0.3
153 0.3
154 0.28
155 0.29
156 0.26
157 0.18
158 0.16
159 0.18
160 0.21
161 0.22
162 0.24
163 0.23
164 0.2
165 0.19
166 0.2
167 0.18
168 0.21
169 0.21
170 0.22
171 0.21
172 0.22
173 0.24
174 0.25
175 0.26
176 0.2
177 0.21
178 0.21
179 0.21
180 0.19
181 0.16
182 0.14
183 0.12
184 0.11
185 0.09
186 0.07
187 0.07
188 0.06
189 0.05
190 0.06
191 0.06
192 0.05
193 0.05
194 0.04
195 0.04
196 0.05
197 0.05
198 0.03
199 0.04
200 0.04
201 0.04
202 0.05
203 0.05
204 0.05
205 0.06
206 0.06
207 0.06
208 0.07
209 0.08
210 0.07
211 0.07
212 0.07
213 0.08
214 0.08
215 0.07
216 0.06
217 0.05
218 0.05
219 0.05
220 0.06
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.03
229 0.03
230 0.03
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.04
240 0.04
241 0.05
242 0.06
243 0.06
244 0.07
245 0.09
246 0.1
247 0.1
248 0.15
249 0.22
250 0.29
251 0.34
252 0.4
253 0.49
254 0.57
255 0.64
256 0.71
257 0.73
258 0.77
259 0.81
260 0.86
261 0.85
262 0.86
263 0.85
264 0.84
265 0.84
266 0.84
267 0.82
268 0.77
269 0.71
270 0.63
271 0.56
272 0.47
273 0.37
274 0.26
275 0.18
276 0.12
277 0.08
278 0.06
279 0.05
280 0.05
281 0.03
282 0.03
283 0.03
284 0.04
285 0.04
286 0.06
287 0.06
288 0.07
289 0.08
290 0.1
291 0.11
292 0.11
293 0.16
294 0.24
295 0.27
296 0.32
297 0.33
298 0.35
299 0.42
300 0.49
301 0.49
302 0.47
303 0.52
304 0.58
305 0.67
306 0.74
307 0.78
308 0.81
309 0.85
310 0.89
311 0.92
312 0.92
313 0.92
314 0.93
315 0.94
316 0.94
317 0.93
318 0.92
319 0.86
320 0.77
321 0.71
322 0.63
323 0.52
324 0.41
325 0.33
326 0.25
327 0.25
328 0.24
329 0.19
330 0.17
331 0.19
332 0.29
333 0.34
334 0.42
335 0.47
336 0.56
337 0.68
338 0.77
339 0.85
340 0.85