Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4M4N5

Protein Details
Accession A0A3N4M4N5   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-60VSKNSAPTPRRTRSRRGKKTVEEQQETDHydrophilic
NLS Segment(s)
PositionSequence
41-51PRRTRSRRGKK
99-99K
101-101R
Subcellular Location(s) nucl 14, cyto_nucl 13.5, cyto 11
Family & Domain DBs
Amino Acid Sequences MAHTRGAAKKAVDDPAEDVPAADQNLVYKDPPVSKNSAPTPRRTRSRRGKKTVEEQQETDEQEALKGDPVTAEAAEEGEADGVVGKHEGQSGRASRSGKNRGRKDMEKPQEAQLVSFPSIMDENVNNTGTIVPFPEPYVPKPRYTPVIPATPKGPMPSVPLKTPKFDPEVHGKDLEKDLQEDSGIDTFEQFIKRSPKKRCMDNKSLDAPTPLDLEAVQVTENQLPDQTEGKKMLSEKPARIEEPLQIEESIPKVKVAITVIYILAPCLTIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.33
4 0.27
5 0.23
6 0.18
7 0.19
8 0.18
9 0.15
10 0.11
11 0.11
12 0.14
13 0.15
14 0.15
15 0.14
16 0.17
17 0.24
18 0.27
19 0.29
20 0.32
21 0.33
22 0.4
23 0.47
24 0.54
25 0.5
26 0.57
27 0.62
28 0.66
29 0.74
30 0.72
31 0.75
32 0.76
33 0.84
34 0.85
35 0.85
36 0.86
37 0.84
38 0.88
39 0.88
40 0.87
41 0.8
42 0.71
43 0.65
44 0.6
45 0.53
46 0.43
47 0.35
48 0.24
49 0.19
50 0.19
51 0.15
52 0.13
53 0.11
54 0.1
55 0.09
56 0.1
57 0.1
58 0.09
59 0.09
60 0.06
61 0.06
62 0.06
63 0.06
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.08
75 0.08
76 0.09
77 0.14
78 0.17
79 0.19
80 0.24
81 0.25
82 0.27
83 0.36
84 0.45
85 0.47
86 0.54
87 0.58
88 0.62
89 0.68
90 0.69
91 0.68
92 0.68
93 0.69
94 0.64
95 0.6
96 0.55
97 0.52
98 0.47
99 0.39
100 0.3
101 0.25
102 0.21
103 0.19
104 0.15
105 0.1
106 0.11
107 0.1
108 0.09
109 0.07
110 0.08
111 0.1
112 0.1
113 0.09
114 0.09
115 0.09
116 0.08
117 0.08
118 0.07
119 0.06
120 0.06
121 0.07
122 0.1
123 0.11
124 0.13
125 0.22
126 0.23
127 0.24
128 0.26
129 0.27
130 0.28
131 0.29
132 0.32
133 0.27
134 0.34
135 0.33
136 0.32
137 0.31
138 0.29
139 0.28
140 0.23
141 0.2
142 0.12
143 0.17
144 0.23
145 0.24
146 0.25
147 0.33
148 0.33
149 0.35
150 0.36
151 0.34
152 0.32
153 0.31
154 0.31
155 0.33
156 0.36
157 0.36
158 0.36
159 0.33
160 0.31
161 0.32
162 0.31
163 0.22
164 0.18
165 0.17
166 0.14
167 0.14
168 0.12
169 0.12
170 0.1
171 0.1
172 0.08
173 0.08
174 0.08
175 0.11
176 0.12
177 0.1
178 0.15
179 0.24
180 0.32
181 0.41
182 0.49
183 0.57
184 0.62
185 0.72
186 0.77
187 0.77
188 0.8
189 0.79
190 0.78
191 0.74
192 0.7
193 0.61
194 0.52
195 0.43
196 0.34
197 0.28
198 0.21
199 0.14
200 0.12
201 0.12
202 0.1
203 0.1
204 0.08
205 0.07
206 0.09
207 0.11
208 0.12
209 0.1
210 0.11
211 0.12
212 0.14
213 0.18
214 0.18
215 0.2
216 0.22
217 0.23
218 0.25
219 0.26
220 0.31
221 0.36
222 0.41
223 0.41
224 0.47
225 0.51
226 0.49
227 0.51
228 0.46
229 0.41
230 0.41
231 0.38
232 0.33
233 0.28
234 0.27
235 0.25
236 0.26
237 0.25
238 0.19
239 0.17
240 0.15
241 0.16
242 0.19
243 0.19
244 0.18
245 0.16
246 0.17
247 0.18
248 0.18
249 0.17
250 0.14
251 0.12