Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LKW0

Protein Details
Accession A0A3N4LKW0   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
224-248EEEIKPKAKKFKSRMREVPRKKGTGBasic
NLS Segment(s)
PositionSequence
228-255KPKAKKFKSRMREVPRKKGTGIGKVKKE
Subcellular Location(s) cyto 16.5, cyto_nucl 13.333, nucl 9, mito_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR025602  BCP1_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF13862  BCCIP  
Amino Acid Sequences MPKRKHGAAPVEAVNDVEVDVDMKGTNSAGSDSDSDSDDFDELPVDFEMFDPQPAHDFHGLKILIRQLLDIDSTLFDISALANLVLSQPLVGTTIKVDTNESDPYAFLTVLNVNLHRKTNPAVETLVNYILEKSKVNEKLHEQLTRILNKKNGAEKGGLGLILTERMVNMPVEVVPPMYKMLQEEVQWALDEKESYDFEAYLILSKTYTEVASQLDAEDGAEEEEEIKPKAKKFKSRMREVPRKKGTGIGKVKKEVGKGVFYFHPEDEVLHAEAIAYTDYNYTKVPEAGTADSKRTFSDFGIVPQGHMILFKKDKLGHVVRELENTFKPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.23
3 0.17
4 0.12
5 0.08
6 0.06
7 0.06
8 0.06
9 0.06
10 0.07
11 0.07
12 0.07
13 0.07
14 0.07
15 0.08
16 0.08
17 0.11
18 0.12
19 0.13
20 0.14
21 0.15
22 0.15
23 0.15
24 0.15
25 0.13
26 0.12
27 0.1
28 0.1
29 0.08
30 0.1
31 0.09
32 0.08
33 0.08
34 0.08
35 0.12
36 0.11
37 0.13
38 0.12
39 0.12
40 0.16
41 0.16
42 0.2
43 0.22
44 0.23
45 0.21
46 0.28
47 0.28
48 0.25
49 0.27
50 0.27
51 0.23
52 0.22
53 0.22
54 0.15
55 0.16
56 0.16
57 0.13
58 0.1
59 0.09
60 0.09
61 0.09
62 0.08
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.04
75 0.03
76 0.04
77 0.06
78 0.06
79 0.06
80 0.06
81 0.09
82 0.1
83 0.1
84 0.11
85 0.11
86 0.14
87 0.15
88 0.15
89 0.13
90 0.12
91 0.13
92 0.13
93 0.12
94 0.08
95 0.08
96 0.08
97 0.1
98 0.11
99 0.12
100 0.13
101 0.15
102 0.17
103 0.16
104 0.17
105 0.18
106 0.22
107 0.22
108 0.21
109 0.21
110 0.2
111 0.21
112 0.21
113 0.2
114 0.14
115 0.13
116 0.12
117 0.11
118 0.12
119 0.11
120 0.1
121 0.17
122 0.24
123 0.25
124 0.28
125 0.3
126 0.36
127 0.4
128 0.41
129 0.34
130 0.33
131 0.37
132 0.4
133 0.39
134 0.35
135 0.34
136 0.34
137 0.37
138 0.36
139 0.33
140 0.29
141 0.27
142 0.24
143 0.22
144 0.2
145 0.16
146 0.1
147 0.08
148 0.06
149 0.05
150 0.05
151 0.04
152 0.03
153 0.04
154 0.05
155 0.04
156 0.04
157 0.04
158 0.04
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.06
165 0.06
166 0.06
167 0.06
168 0.09
169 0.1
170 0.11
171 0.12
172 0.12
173 0.12
174 0.12
175 0.12
176 0.1
177 0.09
178 0.09
179 0.07
180 0.09
181 0.09
182 0.1
183 0.1
184 0.09
185 0.08
186 0.09
187 0.08
188 0.08
189 0.08
190 0.07
191 0.07
192 0.07
193 0.08
194 0.08
195 0.08
196 0.06
197 0.07
198 0.08
199 0.08
200 0.09
201 0.08
202 0.07
203 0.07
204 0.06
205 0.05
206 0.05
207 0.04
208 0.04
209 0.04
210 0.05
211 0.06
212 0.07
213 0.08
214 0.11
215 0.14
216 0.18
217 0.28
218 0.34
219 0.43
220 0.51
221 0.61
222 0.68
223 0.75
224 0.82
225 0.83
226 0.87
227 0.86
228 0.88
229 0.86
230 0.79
231 0.7
232 0.67
233 0.62
234 0.61
235 0.63
236 0.6
237 0.58
238 0.58
239 0.63
240 0.58
241 0.54
242 0.5
243 0.43
244 0.4
245 0.35
246 0.36
247 0.33
248 0.33
249 0.34
250 0.27
251 0.26
252 0.2
253 0.2
254 0.18
255 0.19
256 0.17
257 0.13
258 0.13
259 0.11
260 0.1
261 0.11
262 0.09
263 0.06
264 0.05
265 0.08
266 0.09
267 0.1
268 0.11
269 0.12
270 0.14
271 0.15
272 0.15
273 0.15
274 0.18
275 0.21
276 0.28
277 0.28
278 0.3
279 0.31
280 0.31
281 0.3
282 0.29
283 0.27
284 0.2
285 0.25
286 0.22
287 0.22
288 0.31
289 0.3
290 0.27
291 0.27
292 0.26
293 0.2
294 0.21
295 0.2
296 0.19
297 0.23
298 0.25
299 0.3
300 0.33
301 0.36
302 0.42
303 0.47
304 0.45
305 0.48
306 0.54
307 0.5
308 0.54
309 0.52
310 0.48