Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L6U3

Protein Details
Accession A0A3N4L6U3    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
133-153GREVDKKFRMKKEVRVRRVTVBasic
NLS Segment(s)
Subcellular Location(s) cyto 16.5, cyto_nucl 12.5, cysk 5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029000  Cyclophilin-like_dom_sf  
IPR024936  Cyclophilin-type_PPIase  
IPR002130  Cyclophilin-type_PPIase_dom  
IPR044666  Cyclophilin_A-like  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0000413  P:protein peptidyl-prolyl isomerization  
Pfam View protein in Pfam  
PF00160  Pro_isomerase  
PROSITE View protein in PROSITE  
PS50072  CSA_PPIASE_2  
CDD cd01928  Cyclophilin_PPIL3_like  
Amino Acid Sequences MSVTLHTDLGDIKIEVFCEAVPKTAENFLALCASGYYDNVLIHRNIKGFIFQLGDPLGTGKGGASIWGGKFEDEIRPALRHNQRGVVSMANSGPDTNGSQFFVTYGSHPHLDGRNTVFGKVIGGWEVLDELEGREVDKKFRMKKEVRVRRVTVHANPIAEREEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.09
5 0.11
6 0.12
7 0.13
8 0.14
9 0.14
10 0.16
11 0.19
12 0.19
13 0.16
14 0.16
15 0.14
16 0.14
17 0.13
18 0.11
19 0.08
20 0.09
21 0.08
22 0.08
23 0.08
24 0.08
25 0.09
26 0.09
27 0.11
28 0.11
29 0.13
30 0.15
31 0.15
32 0.14
33 0.14
34 0.15
35 0.14
36 0.15
37 0.15
38 0.12
39 0.14
40 0.13
41 0.13
42 0.11
43 0.11
44 0.09
45 0.06
46 0.07
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.07
53 0.07
54 0.09
55 0.1
56 0.08
57 0.09
58 0.1
59 0.12
60 0.11
61 0.12
62 0.12
63 0.12
64 0.13
65 0.21
66 0.26
67 0.27
68 0.27
69 0.31
70 0.3
71 0.31
72 0.32
73 0.25
74 0.2
75 0.17
76 0.16
77 0.12
78 0.11
79 0.09
80 0.07
81 0.07
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.09
88 0.09
89 0.09
90 0.08
91 0.08
92 0.09
93 0.11
94 0.11
95 0.12
96 0.14
97 0.17
98 0.18
99 0.2
100 0.21
101 0.26
102 0.25
103 0.26
104 0.23
105 0.2
106 0.2
107 0.17
108 0.15
109 0.08
110 0.08
111 0.08
112 0.07
113 0.07
114 0.06
115 0.06
116 0.05
117 0.05
118 0.07
119 0.07
120 0.07
121 0.12
122 0.13
123 0.17
124 0.23
125 0.31
126 0.37
127 0.45
128 0.55
129 0.56
130 0.66
131 0.74
132 0.79
133 0.8
134 0.81
135 0.77
136 0.74
137 0.76
138 0.73
139 0.68
140 0.66
141 0.61
142 0.54
143 0.51
144 0.47