Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4M3T1

Protein Details
Accession A0A3N4M3T1   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
65-91RQFGVPRFPCKKKKICSRPCLRLQLAQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 6.5, cyto_nucl 4.5, extr 4
Family & Domain DBs
Amino Acid Sequences MHQLLRGGSRVITVFLYVSCLVSRISSSSTFNSAPFRQPLTGSDKSCIQIPSTSPGYPAFPKSVRQFGVPRFPCKKKKICSRPCLRLQLAQATGGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.13
4 0.11
5 0.12
6 0.1
7 0.11
8 0.1
9 0.1
10 0.11
11 0.09
12 0.11
13 0.12
14 0.15
15 0.16
16 0.19
17 0.19
18 0.2
19 0.24
20 0.23
21 0.24
22 0.24
23 0.24
24 0.21
25 0.21
26 0.23
27 0.26
28 0.3
29 0.27
30 0.27
31 0.26
32 0.26
33 0.28
34 0.25
35 0.18
36 0.14
37 0.14
38 0.18
39 0.18
40 0.17
41 0.16
42 0.16
43 0.18
44 0.18
45 0.19
46 0.18
47 0.17
48 0.22
49 0.25
50 0.3
51 0.28
52 0.3
53 0.34
54 0.34
55 0.44
56 0.43
57 0.48
58 0.5
59 0.58
60 0.63
61 0.67
62 0.72
63 0.71
64 0.79
65 0.82
66 0.85
67 0.87
68 0.88
69 0.89
70 0.89
71 0.88
72 0.8
73 0.75
74 0.69
75 0.67
76 0.58
77 0.52
78 0.46