Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4M2E2

Protein Details
Accession A0A3N4M2E2    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
111-137SELPVHPKKDPKRTQKGPPKPIPPMTSHydrophilic
NLS Segment(s)
PositionSequence
104-131KRRVTRPSELPVHPKKDPKRTQKGPPKP
Subcellular Location(s) nucl 13, mito 10, cyto_nucl 9.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MQLILSQSRRSRTESNSRPSPADMRIPTAAYLSHLTTTERFTQKRTASCTYSCPKARCYNIRIANREGLMIYSRDLAILAPVAPNYCRFCFKLEIPHFFHHHGKRRVTRPSELPVHPKKDPKRTQKGPPKPIPPMTSSSPSPTPRTTFPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.66
4 0.67
5 0.63
6 0.6
7 0.56
8 0.49
9 0.48
10 0.4
11 0.37
12 0.36
13 0.34
14 0.31
15 0.28
16 0.24
17 0.17
18 0.18
19 0.14
20 0.13
21 0.13
22 0.14
23 0.15
24 0.18
25 0.23
26 0.27
27 0.27
28 0.29
29 0.37
30 0.4
31 0.44
32 0.47
33 0.44
34 0.42
35 0.43
36 0.47
37 0.43
38 0.46
39 0.47
40 0.42
41 0.42
42 0.46
43 0.51
44 0.5
45 0.51
46 0.52
47 0.55
48 0.6
49 0.59
50 0.54
51 0.5
52 0.43
53 0.39
54 0.3
55 0.21
56 0.16
57 0.12
58 0.09
59 0.07
60 0.07
61 0.07
62 0.07
63 0.06
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.08
72 0.11
73 0.12
74 0.15
75 0.15
76 0.18
77 0.22
78 0.23
79 0.31
80 0.33
81 0.39
82 0.41
83 0.44
84 0.44
85 0.43
86 0.5
87 0.47
88 0.52
89 0.53
90 0.56
91 0.6
92 0.65
93 0.71
94 0.68
95 0.66
96 0.62
97 0.62
98 0.61
99 0.57
100 0.59
101 0.58
102 0.59
103 0.57
104 0.61
105 0.62
106 0.65
107 0.72
108 0.73
109 0.76
110 0.78
111 0.84
112 0.86
113 0.89
114 0.89
115 0.88
116 0.86
117 0.83
118 0.83
119 0.76
120 0.69
121 0.63
122 0.59
123 0.55
124 0.48
125 0.46
126 0.46
127 0.46
128 0.48
129 0.47
130 0.45