Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LJN2

Protein Details
Accession A0A3N4LJN2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-69LVLRKTRRFRGDRYHWKKECBasic
NLS Segment(s)
Subcellular Location(s) mito 7, plas 6, extr 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKMVVVVDVDQYIPSREVHDPGRMWRNVLQARLIRTFAAGVFCLCILGDLVLRKTRRFRGDRYHWKKECGVLIFQAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.15
4 0.18
5 0.2
6 0.25
7 0.25
8 0.3
9 0.37
10 0.34
11 0.35
12 0.35
13 0.41
14 0.38
15 0.38
16 0.36
17 0.31
18 0.34
19 0.34
20 0.31
21 0.22
22 0.19
23 0.18
24 0.14
25 0.12
26 0.08
27 0.06
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.04
34 0.04
35 0.05
36 0.06
37 0.09
38 0.14
39 0.15
40 0.18
41 0.24
42 0.31
43 0.39
44 0.43
45 0.48
46 0.54
47 0.64
48 0.73
49 0.77
50 0.81
51 0.75
52 0.75
53 0.71
54 0.66
55 0.62
56 0.54
57 0.48