Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1X0N3

Protein Details
Accession K1X0N3    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
223-244ESEKKPKKPTVPGRGRGRPPKSBasic
NLS Segment(s)
PositionSequence
206-342KPKYEPSGRPRGRPAMAESEKKPKKPTVPGRGRGRPPKSDAEKTAAAKTKAALKPAPKPQPAKIEKAPKTNPAKEASTPKKRGRPAAADVEEESRTPAKRGRPSKGEAEETASKKRGRPASVAPHTKTPSSMKRERL
349-382EEKTPVTKKRKTSATPASSAPASSAKKSGKKAKA
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
KEGG mbe:MBM_03530  -  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MASSISADEFKDALARYPAVIQKFSKTRKAGSASLEELDKFRYQVAPINFSMKTGRLMAMDDLKKLVEWKLNHGIYRPTMTKMIASNTNEKLEAATTAAFAAYANGESISAVIEKIKEPLKGVGPATASLILAVHDPQNIIFFSDELFRWLTAGGKKVKITYSTKEFETLFKAAGNFMSKIKCTPIELEKVAFVLIKENEPVHEPKPKYEPSGRPRGRPAMAESEKKPKKPTVPGRGRGRPPKSDAEKTAAAKTKAALKPAPKPQPAKIEKAPKTNPAKEASTPKKRGRPAAADVEEESRTPAKRGRPSKGEAEETASKKRGRPASVAPHTKTPSSMKRERLSLASAAEEKTPVTKKRKTSATPASSAPASSAKKSGKKAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.24
5 0.29
6 0.28
7 0.32
8 0.31
9 0.35
10 0.44
11 0.49
12 0.52
13 0.52
14 0.53
15 0.57
16 0.62
17 0.58
18 0.54
19 0.55
20 0.48
21 0.46
22 0.43
23 0.35
24 0.3
25 0.29
26 0.24
27 0.18
28 0.17
29 0.17
30 0.17
31 0.24
32 0.27
33 0.29
34 0.29
35 0.34
36 0.32
37 0.31
38 0.32
39 0.26
40 0.24
41 0.21
42 0.21
43 0.17
44 0.19
45 0.2
46 0.27
47 0.27
48 0.25
49 0.24
50 0.22
51 0.22
52 0.22
53 0.23
54 0.2
55 0.2
56 0.27
57 0.36
58 0.38
59 0.39
60 0.4
61 0.41
62 0.37
63 0.41
64 0.36
65 0.29
66 0.28
67 0.28
68 0.28
69 0.26
70 0.27
71 0.28
72 0.3
73 0.34
74 0.35
75 0.36
76 0.33
77 0.31
78 0.27
79 0.21
80 0.18
81 0.12
82 0.1
83 0.08
84 0.08
85 0.08
86 0.07
87 0.06
88 0.06
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.07
101 0.07
102 0.11
103 0.14
104 0.14
105 0.15
106 0.18
107 0.21
108 0.23
109 0.23
110 0.23
111 0.21
112 0.2
113 0.2
114 0.17
115 0.14
116 0.1
117 0.1
118 0.07
119 0.07
120 0.07
121 0.07
122 0.06
123 0.07
124 0.07
125 0.08
126 0.08
127 0.08
128 0.08
129 0.07
130 0.07
131 0.09
132 0.09
133 0.09
134 0.1
135 0.09
136 0.09
137 0.09
138 0.12
139 0.12
140 0.17
141 0.19
142 0.21
143 0.22
144 0.23
145 0.25
146 0.27
147 0.29
148 0.29
149 0.32
150 0.32
151 0.32
152 0.32
153 0.31
154 0.27
155 0.27
156 0.23
157 0.16
158 0.15
159 0.14
160 0.12
161 0.13
162 0.13
163 0.11
164 0.12
165 0.13
166 0.12
167 0.13
168 0.14
169 0.14
170 0.13
171 0.15
172 0.17
173 0.2
174 0.2
175 0.2
176 0.18
177 0.18
178 0.17
179 0.14
180 0.1
181 0.09
182 0.09
183 0.09
184 0.1
185 0.1
186 0.1
187 0.12
188 0.15
189 0.13
190 0.2
191 0.2
192 0.22
193 0.29
194 0.3
195 0.32
196 0.38
197 0.45
198 0.44
199 0.55
200 0.54
201 0.52
202 0.55
203 0.56
204 0.5
205 0.42
206 0.4
207 0.39
208 0.41
209 0.42
210 0.4
211 0.45
212 0.47
213 0.47
214 0.48
215 0.42
216 0.45
217 0.51
218 0.58
219 0.59
220 0.65
221 0.72
222 0.78
223 0.81
224 0.82
225 0.81
226 0.76
227 0.7
228 0.65
229 0.66
230 0.63
231 0.61
232 0.56
233 0.51
234 0.51
235 0.48
236 0.49
237 0.45
238 0.39
239 0.34
240 0.32
241 0.36
242 0.33
243 0.34
244 0.31
245 0.31
246 0.38
247 0.47
248 0.55
249 0.52
250 0.54
251 0.56
252 0.63
253 0.63
254 0.61
255 0.6
256 0.61
257 0.61
258 0.66
259 0.64
260 0.62
261 0.67
262 0.65
263 0.62
264 0.56
265 0.54
266 0.5
267 0.57
268 0.58
269 0.59
270 0.62
271 0.65
272 0.69
273 0.7
274 0.73
275 0.71
276 0.68
277 0.64
278 0.66
279 0.61
280 0.54
281 0.51
282 0.46
283 0.38
284 0.31
285 0.27
286 0.2
287 0.18
288 0.19
289 0.23
290 0.28
291 0.37
292 0.45
293 0.51
294 0.55
295 0.59
296 0.66
297 0.68
298 0.64
299 0.56
300 0.54
301 0.54
302 0.5
303 0.52
304 0.48
305 0.44
306 0.43
307 0.49
308 0.5
309 0.46
310 0.49
311 0.52
312 0.58
313 0.65
314 0.7
315 0.65
316 0.66
317 0.64
318 0.59
319 0.54
320 0.51
321 0.5
322 0.51
323 0.56
324 0.56
325 0.58
326 0.62
327 0.61
328 0.56
329 0.51
330 0.45
331 0.39
332 0.34
333 0.32
334 0.28
335 0.26
336 0.23
337 0.19
338 0.23
339 0.28
340 0.32
341 0.39
342 0.45
343 0.52
344 0.61
345 0.71
346 0.69
347 0.73
348 0.76
349 0.74
350 0.71
351 0.65
352 0.6
353 0.51
354 0.46
355 0.38
356 0.35
357 0.31
358 0.29
359 0.35
360 0.39
361 0.45
362 0.54