Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4M496

Protein Details
Accession A0A3N4M496   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-45MASIKIVKKRTKPFARHQSHDYKCVKSSWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
30-42RKPKGIDNRVRRR
Subcellular Location(s) mito 15.5, mito_nucl 11, cyto 6, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MASIKIVKKRTKPFARHQSHDYKCVKSSWRKPKGIDNRVRRRFKGQLAMPSIGYGSNKKTKYKMPSGHKAFLVQNTADVELLLMHNKTFAAEIGHAVSSRKRVEIIAKAKALGVKVTNPKGRVTTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.82
4 0.8
5 0.8
6 0.74
7 0.75
8 0.68
9 0.61
10 0.54
11 0.53
12 0.54
13 0.53
14 0.59
15 0.61
16 0.66
17 0.68
18 0.69
19 0.74
20 0.77
21 0.77
22 0.77
23 0.76
24 0.77
25 0.82
26 0.86
27 0.78
28 0.74
29 0.7
30 0.66
31 0.64
32 0.57
33 0.55
34 0.54
35 0.53
36 0.45
37 0.38
38 0.33
39 0.24
40 0.2
41 0.13
42 0.13
43 0.19
44 0.21
45 0.23
46 0.25
47 0.31
48 0.37
49 0.44
50 0.49
51 0.5
52 0.58
53 0.62
54 0.62
55 0.57
56 0.53
57 0.45
58 0.39
59 0.34
60 0.24
61 0.19
62 0.16
63 0.16
64 0.13
65 0.11
66 0.09
67 0.06
68 0.07
69 0.07
70 0.06
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.08
79 0.09
80 0.1
81 0.11
82 0.11
83 0.12
84 0.13
85 0.16
86 0.17
87 0.17
88 0.16
89 0.18
90 0.24
91 0.32
92 0.37
93 0.39
94 0.39
95 0.38
96 0.39
97 0.39
98 0.34
99 0.27
100 0.23
101 0.23
102 0.31
103 0.39
104 0.43
105 0.43
106 0.45
107 0.46