Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LI17

Protein Details
Accession A0A3N4LI17    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-107LISPMWPRERRAKKPPRPIYQQVAVHydrophilic
NLS Segment(s)
PositionSequence
91-98ERRAKKPP
Subcellular Location(s) cysk 23, cyto 4
Family & Domain DBs
Amino Acid Sequences MWELIEVLKVMPWDDLILELLGEVLGIYRKILAHRYVAARGSAGRHYSRGISILENLIRNYPESAFLNLFRMHRISFWKLVDLISPMWPRERRAKKPPRPIYQQVAVALYVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.07
6 0.06
7 0.06
8 0.05
9 0.05
10 0.04
11 0.03
12 0.04
13 0.04
14 0.04
15 0.05
16 0.07
17 0.08
18 0.12
19 0.14
20 0.15
21 0.19
22 0.22
23 0.24
24 0.24
25 0.22
26 0.19
27 0.18
28 0.18
29 0.17
30 0.17
31 0.15
32 0.15
33 0.16
34 0.16
35 0.16
36 0.15
37 0.14
38 0.11
39 0.11
40 0.12
41 0.13
42 0.13
43 0.13
44 0.12
45 0.11
46 0.11
47 0.11
48 0.09
49 0.1
50 0.11
51 0.13
52 0.13
53 0.13
54 0.16
55 0.17
56 0.17
57 0.16
58 0.16
59 0.14
60 0.15
61 0.2
62 0.21
63 0.24
64 0.25
65 0.25
66 0.24
67 0.24
68 0.23
69 0.2
70 0.17
71 0.19
72 0.2
73 0.19
74 0.25
75 0.27
76 0.3
77 0.38
78 0.47
79 0.5
80 0.59
81 0.7
82 0.73
83 0.82
84 0.89
85 0.88
86 0.88
87 0.87
88 0.84
89 0.8
90 0.74
91 0.65
92 0.56