Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4M702

Protein Details
Accession A0A3N4M702    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
97-123AYESSLKTAKEKKKQTHFPQRKFAVKVHydrophilic
NLS Segment(s)
PositionSequence
84-95RPKKTRAIRRRL
103-110KTAKEKKK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGVKAAQLWSKNKTELTKQLDDLKSELQQLRVQKMTGGAASKLTKIHDVRKAIAKVLTVINVQQRHQLRLFYKGKKYLPLDLRPKKTRAIRRRLTAYESSLKTAKEKKKQTHFPQRKFAVKVGISGYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.48
4 0.52
5 0.51
6 0.5
7 0.56
8 0.54
9 0.5
10 0.45
11 0.39
12 0.33
13 0.34
14 0.32
15 0.26
16 0.27
17 0.29
18 0.32
19 0.3
20 0.29
21 0.24
22 0.24
23 0.22
24 0.2
25 0.18
26 0.14
27 0.16
28 0.16
29 0.17
30 0.16
31 0.16
32 0.2
33 0.21
34 0.27
35 0.29
36 0.31
37 0.33
38 0.39
39 0.39
40 0.35
41 0.34
42 0.27
43 0.23
44 0.21
45 0.19
46 0.12
47 0.13
48 0.16
49 0.16
50 0.16
51 0.2
52 0.21
53 0.23
54 0.23
55 0.26
56 0.22
57 0.3
58 0.37
59 0.37
60 0.41
61 0.45
62 0.45
63 0.48
64 0.49
65 0.48
66 0.48
67 0.5
68 0.56
69 0.58
70 0.66
71 0.64
72 0.63
73 0.62
74 0.64
75 0.66
76 0.66
77 0.68
78 0.67
79 0.7
80 0.76
81 0.72
82 0.69
83 0.63
84 0.58
85 0.56
86 0.49
87 0.45
88 0.39
89 0.37
90 0.36
91 0.42
92 0.45
93 0.47
94 0.55
95 0.62
96 0.7
97 0.8
98 0.86
99 0.88
100 0.9
101 0.89
102 0.89
103 0.88
104 0.85
105 0.78
106 0.71
107 0.69
108 0.59
109 0.54