Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4L5X3

Protein Details
Accession A0A3N4L5X3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
121-141SMPLPFRSRSRPRSKSPLIPTHydrophilic
NLS Segment(s)
PositionSequence
128-132SRSRP
Subcellular Location(s) cyto 12, nucl 6, mito 5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029498  HeLo_dom  
IPR038305  HeLo_sf  
Pfam View protein in Pfam  
PF14479  HeLo  
Amino Acid Sequences MDPASLTIGVVGLAGQLAKAAADYYKIFDDMSDVGTTYDSILHKLRTEGLRLKGWEEAWGLGNDNNQRRLDPKDYRYRYATATLARIVAAFASVEKLQAKYGIAVKGKSLEAEEPKPRRQSMPLPFRSRSRPRSKSPLIPTIQETDLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.04
8 0.04
9 0.07
10 0.08
11 0.1
12 0.12
13 0.12
14 0.12
15 0.11
16 0.13
17 0.11
18 0.13
19 0.11
20 0.1
21 0.1
22 0.1
23 0.1
24 0.08
25 0.11
26 0.09
27 0.11
28 0.13
29 0.14
30 0.15
31 0.15
32 0.2
33 0.18
34 0.23
35 0.26
36 0.28
37 0.32
38 0.32
39 0.32
40 0.29
41 0.28
42 0.25
43 0.2
44 0.17
45 0.14
46 0.13
47 0.13
48 0.11
49 0.14
50 0.17
51 0.19
52 0.22
53 0.2
54 0.2
55 0.22
56 0.26
57 0.3
58 0.32
59 0.36
60 0.43
61 0.46
62 0.49
63 0.49
64 0.46
65 0.41
66 0.37
67 0.33
68 0.24
69 0.22
70 0.2
71 0.17
72 0.15
73 0.13
74 0.1
75 0.07
76 0.06
77 0.04
78 0.03
79 0.05
80 0.05
81 0.07
82 0.08
83 0.08
84 0.09
85 0.1
86 0.1
87 0.11
88 0.14
89 0.18
90 0.2
91 0.19
92 0.2
93 0.22
94 0.21
95 0.19
96 0.17
97 0.17
98 0.2
99 0.26
100 0.34
101 0.37
102 0.43
103 0.48
104 0.49
105 0.47
106 0.48
107 0.51
108 0.53
109 0.58
110 0.61
111 0.64
112 0.65
113 0.67
114 0.72
115 0.72
116 0.72
117 0.72
118 0.71
119 0.72
120 0.79
121 0.82
122 0.82
123 0.8
124 0.79
125 0.72
126 0.67
127 0.62
128 0.57