Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LMG7

Protein Details
Accession A0A3N4LMG7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
104-125GGKGGRPKYKTKFKNGAQKLKVBasic
NLS Segment(s)
PositionSequence
83-119KKGKIQGGKKPIYFGVEGGVKGGKGGRPKYKTKFKNG
Subcellular Location(s) mito 19, cyto 4.5, cyto_nucl 3, extr 2
Family & Domain DBs
Amino Acid Sequences MGGGCALSIAYKTVGKPSKDDFIVISVNHNCPQLGPFTHSFPMPENLPECEACTCAWTWVPDERSSADEMYMNTFNCKVTGGKKGKIQGGKKPIYFGVEGGVKGGKGGRPKYKTKFKNGAQKLKVQWLTTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.32
4 0.34
5 0.4
6 0.38
7 0.39
8 0.31
9 0.28
10 0.29
11 0.25
12 0.27
13 0.23
14 0.25
15 0.26
16 0.25
17 0.21
18 0.19
19 0.2
20 0.18
21 0.16
22 0.18
23 0.18
24 0.21
25 0.22
26 0.22
27 0.22
28 0.21
29 0.22
30 0.18
31 0.18
32 0.16
33 0.16
34 0.18
35 0.17
36 0.16
37 0.14
38 0.14
39 0.11
40 0.11
41 0.1
42 0.09
43 0.1
44 0.09
45 0.11
46 0.14
47 0.16
48 0.16
49 0.17
50 0.17
51 0.18
52 0.18
53 0.16
54 0.12
55 0.11
56 0.1
57 0.13
58 0.13
59 0.12
60 0.11
61 0.12
62 0.11
63 0.1
64 0.11
65 0.09
66 0.11
67 0.21
68 0.25
69 0.28
70 0.32
71 0.36
72 0.41
73 0.47
74 0.48
75 0.47
76 0.52
77 0.54
78 0.51
79 0.48
80 0.44
81 0.39
82 0.36
83 0.27
84 0.22
85 0.18
86 0.17
87 0.16
88 0.15
89 0.12
90 0.12
91 0.14
92 0.13
93 0.18
94 0.25
95 0.33
96 0.39
97 0.48
98 0.58
99 0.67
100 0.72
101 0.75
102 0.79
103 0.77
104 0.82
105 0.84
106 0.85
107 0.78
108 0.79
109 0.74
110 0.74
111 0.7