Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LM61

Protein Details
Accession A0A3N4LM61    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
93-113NTNWRKKTSNWRKKTSNWRKIHydrophilic
NLS Segment(s)
PositionSequence
97-106RKKTSNWRKK
Subcellular Location(s) nucl 13, mito 8, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MPAVDVYLVAAGTVSNPRNEKQLTEILTQVSNFRRMIHTARYSNSIIGEYKQLPIKLKKGTFCSYPYRKITSSINTNWRKKTSEAKLKNFRINTNWRKKTSNWRKKTSNWRKITSSIKLKNFSFNTIELEKKDFENLQLQLRESNNKSLFTSGNLCTIAKDQGDRYSGHCLGTRILPRSEPDLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.2
4 0.21
5 0.28
6 0.29
7 0.29
8 0.29
9 0.34
10 0.34
11 0.33
12 0.34
13 0.29
14 0.3
15 0.28
16 0.28
17 0.24
18 0.24
19 0.22
20 0.22
21 0.23
22 0.25
23 0.3
24 0.33
25 0.38
26 0.37
27 0.39
28 0.42
29 0.41
30 0.38
31 0.34
32 0.28
33 0.21
34 0.18
35 0.21
36 0.17
37 0.18
38 0.21
39 0.22
40 0.25
41 0.28
42 0.33
43 0.36
44 0.39
45 0.41
46 0.44
47 0.45
48 0.43
49 0.43
50 0.47
51 0.46
52 0.49
53 0.49
54 0.47
55 0.44
56 0.44
57 0.44
58 0.4
59 0.41
60 0.39
61 0.45
62 0.49
63 0.54
64 0.55
65 0.53
66 0.5
67 0.46
68 0.5
69 0.49
70 0.52
71 0.55
72 0.61
73 0.68
74 0.7
75 0.73
76 0.65
77 0.57
78 0.53
79 0.54
80 0.55
81 0.56
82 0.58
83 0.56
84 0.57
85 0.59
86 0.64
87 0.65
88 0.66
89 0.63
90 0.65
91 0.68
92 0.73
93 0.81
94 0.81
95 0.8
96 0.76
97 0.73
98 0.68
99 0.68
100 0.66
101 0.63
102 0.62
103 0.59
104 0.58
105 0.58
106 0.55
107 0.58
108 0.52
109 0.47
110 0.39
111 0.33
112 0.31
113 0.29
114 0.3
115 0.23
116 0.25
117 0.22
118 0.2
119 0.22
120 0.18
121 0.17
122 0.21
123 0.22
124 0.26
125 0.26
126 0.26
127 0.28
128 0.3
129 0.35
130 0.32
131 0.39
132 0.35
133 0.35
134 0.35
135 0.33
136 0.32
137 0.28
138 0.31
139 0.22
140 0.24
141 0.23
142 0.22
143 0.21
144 0.22
145 0.22
146 0.19
147 0.2
148 0.18
149 0.22
150 0.25
151 0.25
152 0.26
153 0.31
154 0.3
155 0.3
156 0.31
157 0.27
158 0.27
159 0.33
160 0.37
161 0.33
162 0.34
163 0.35
164 0.34