Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LG34

Protein Details
Accession A0A3N4LG34    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGGKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
6-22GGKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 13, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGGKKQKKKWSKGKVKDKAQHAVILDKVTSDKLNKDVQNYRLITVAVLVDRLKINGSLARRALTDLEARGVIKKVVGHSKCTIYSTFACSIPSQSRRWKTPRSAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.93
7 0.9
8 0.86
9 0.82
10 0.73
11 0.66
12 0.56
13 0.49
14 0.4
15 0.34
16 0.26
17 0.19
18 0.17
19 0.15
20 0.15
21 0.13
22 0.13
23 0.16
24 0.23
25 0.24
26 0.29
27 0.33
28 0.35
29 0.41
30 0.4
31 0.36
32 0.31
33 0.29
34 0.23
35 0.18
36 0.15
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.07
46 0.09
47 0.11
48 0.13
49 0.14
50 0.14
51 0.14
52 0.15
53 0.15
54 0.14
55 0.14
56 0.11
57 0.12
58 0.12
59 0.12
60 0.13
61 0.13
62 0.11
63 0.1
64 0.11
65 0.14
66 0.23
67 0.25
68 0.28
69 0.31
70 0.34
71 0.35
72 0.35
73 0.32
74 0.27
75 0.28
76 0.28
77 0.27
78 0.24
79 0.24
80 0.23
81 0.27
82 0.31
83 0.34
84 0.35
85 0.43
86 0.5
87 0.57
88 0.64
89 0.69