Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LKK8

Protein Details
Accession A0A3N4LKK8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-35SDAVPVRREKEKKVRYRNVNAALIHydrophilic
NLS Segment(s)
PositionSequence
98-106KSRKGSKAK
Subcellular Location(s) nucl 16, cyto_nucl 11.333, mito_nucl 11.333, mito 5.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSVVLGLKDCRSDAVPVRREKEKKVRYRNVNAALIGTVREGVADRNQAVWTEKNKYKMNDVHGPRTTSKEIGQLLAKKASTLRRDWQTSEDYSLRSGKSRKGSKAKRVAMISSIHSEVDDDAIPGVAYSFDEYSGPSYGTDILATLVDQAEIKYENKVFDKLVKAEYEMVETTSEEDSDEEFELIDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.48
4 0.53
5 0.6
6 0.62
7 0.67
8 0.69
9 0.69
10 0.72
11 0.76
12 0.82
13 0.82
14 0.88
15 0.88
16 0.85
17 0.79
18 0.68
19 0.58
20 0.48
21 0.38
22 0.29
23 0.19
24 0.12
25 0.07
26 0.07
27 0.07
28 0.08
29 0.11
30 0.13
31 0.13
32 0.15
33 0.15
34 0.16
35 0.19
36 0.21
37 0.22
38 0.28
39 0.31
40 0.36
41 0.41
42 0.42
43 0.46
44 0.47
45 0.49
46 0.5
47 0.52
48 0.53
49 0.51
50 0.53
51 0.47
52 0.47
53 0.42
54 0.34
55 0.31
56 0.28
57 0.25
58 0.24
59 0.26
60 0.24
61 0.24
62 0.25
63 0.24
64 0.19
65 0.22
66 0.26
67 0.25
68 0.26
69 0.3
70 0.33
71 0.36
72 0.37
73 0.37
74 0.34
75 0.32
76 0.32
77 0.27
78 0.21
79 0.2
80 0.21
81 0.18
82 0.18
83 0.19
84 0.2
85 0.27
86 0.33
87 0.39
88 0.48
89 0.55
90 0.62
91 0.7
92 0.7
93 0.66
94 0.62
95 0.55
96 0.48
97 0.42
98 0.34
99 0.26
100 0.22
101 0.17
102 0.15
103 0.14
104 0.11
105 0.1
106 0.08
107 0.06
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.03
114 0.03
115 0.05
116 0.05
117 0.05
118 0.06
119 0.06
120 0.08
121 0.09
122 0.09
123 0.08
124 0.09
125 0.09
126 0.09
127 0.09
128 0.07
129 0.07
130 0.06
131 0.06
132 0.06
133 0.05
134 0.06
135 0.06
136 0.05
137 0.07
138 0.09
139 0.09
140 0.13
141 0.14
142 0.18
143 0.2
144 0.22
145 0.22
146 0.26
147 0.31
148 0.3
149 0.32
150 0.3
151 0.29
152 0.31
153 0.3
154 0.28
155 0.22
156 0.21
157 0.18
158 0.17
159 0.17
160 0.14
161 0.13
162 0.1
163 0.11
164 0.11
165 0.12
166 0.13
167 0.11