Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LVQ1

Protein Details
Accession A0A3N4LVQ1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-69EMTFACKKCKKCFRKETQDWDESHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences MRRRLTDSSKHILNAQVSIRSPCCKKWFDCAQCHAESEKHVLLQRTEMTFACKKCKKCFRKETQDWDESDEYCPHCDNHFVIDAKEPKAMLQVEGEDVRVDARMLKDDRVKGQDQIASIFDIGDDFADKLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.3
4 0.28
5 0.31
6 0.31
7 0.32
8 0.33
9 0.35
10 0.39
11 0.4
12 0.41
13 0.47
14 0.55
15 0.57
16 0.63
17 0.62
18 0.62
19 0.57
20 0.57
21 0.5
22 0.4
23 0.33
24 0.31
25 0.25
26 0.22
27 0.23
28 0.23
29 0.21
30 0.23
31 0.24
32 0.2
33 0.2
34 0.18
35 0.21
36 0.24
37 0.25
38 0.31
39 0.34
40 0.37
41 0.44
42 0.55
43 0.59
44 0.65
45 0.74
46 0.75
47 0.81
48 0.85
49 0.86
50 0.82
51 0.77
52 0.67
53 0.61
54 0.52
55 0.41
56 0.35
57 0.27
58 0.2
59 0.17
60 0.17
61 0.13
62 0.13
63 0.14
64 0.12
65 0.12
66 0.16
67 0.16
68 0.16
69 0.21
70 0.24
71 0.24
72 0.24
73 0.22
74 0.17
75 0.21
76 0.21
77 0.15
78 0.13
79 0.12
80 0.14
81 0.14
82 0.15
83 0.1
84 0.1
85 0.09
86 0.08
87 0.08
88 0.08
89 0.09
90 0.15
91 0.17
92 0.21
93 0.27
94 0.3
95 0.36
96 0.39
97 0.4
98 0.36
99 0.39
100 0.37
101 0.32
102 0.31
103 0.26
104 0.22
105 0.2
106 0.17
107 0.12
108 0.1
109 0.09
110 0.07
111 0.08