Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LX08

Protein Details
Accession A0A3N4LX08    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
24-50AGEGKNQKPQRTRKRKARTQSPCASSEHydrophilic
NLS Segment(s)
PositionSequence
30-40QKPQRTRKRKA
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MSDSQAKTPAEQTLPVGSAPATHAGEGKNQKPQRTRKRKARTQSPCASSEKILDEFQSMDTHRPYVDSSEVLAGQLPQSKSNTPRTFQLPKAKRLKSQKCTSSYGLEILKNTHADILSEPCPIVAKVMMESFSGTRVVQDDNAMVRLTKAKDCLSQFDTDFLSELGNGDKIEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.2
4 0.15
5 0.14
6 0.14
7 0.17
8 0.14
9 0.13
10 0.15
11 0.16
12 0.24
13 0.29
14 0.31
15 0.36
16 0.39
17 0.46
18 0.53
19 0.63
20 0.66
21 0.71
22 0.79
23 0.8
24 0.88
25 0.9
26 0.92
27 0.92
28 0.9
29 0.89
30 0.88
31 0.81
32 0.74
33 0.69
34 0.61
35 0.5
36 0.43
37 0.37
38 0.3
39 0.25
40 0.22
41 0.18
42 0.17
43 0.17
44 0.16
45 0.14
46 0.14
47 0.14
48 0.14
49 0.13
50 0.13
51 0.13
52 0.13
53 0.13
54 0.11
55 0.11
56 0.11
57 0.11
58 0.1
59 0.1
60 0.07
61 0.07
62 0.11
63 0.11
64 0.11
65 0.13
66 0.15
67 0.19
68 0.29
69 0.31
70 0.28
71 0.31
72 0.35
73 0.38
74 0.42
75 0.48
76 0.43
77 0.49
78 0.57
79 0.57
80 0.57
81 0.64
82 0.68
83 0.67
84 0.7
85 0.69
86 0.64
87 0.67
88 0.62
89 0.55
90 0.45
91 0.4
92 0.34
93 0.27
94 0.23
95 0.2
96 0.19
97 0.16
98 0.15
99 0.13
100 0.11
101 0.11
102 0.11
103 0.14
104 0.13
105 0.13
106 0.13
107 0.11
108 0.13
109 0.12
110 0.11
111 0.08
112 0.08
113 0.09
114 0.1
115 0.11
116 0.1
117 0.11
118 0.11
119 0.11
120 0.11
121 0.1
122 0.09
123 0.1
124 0.11
125 0.11
126 0.12
127 0.13
128 0.13
129 0.15
130 0.14
131 0.13
132 0.12
133 0.17
134 0.19
135 0.2
136 0.22
137 0.24
138 0.3
139 0.33
140 0.38
141 0.36
142 0.38
143 0.36
144 0.35
145 0.33
146 0.27
147 0.25
148 0.19
149 0.16
150 0.12
151 0.12
152 0.11
153 0.11