Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LSN7

Protein Details
Accession A0A3N4LSN7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-25HTYRCIFPKQQQKKRVLPFSFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8plas 8, E.R. 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSCIHTYRCIFPKQQQKKRVLPFSFLFFSSHNWLILGLRYCIVCIVGIYCSFASPFETF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.69
3 0.72
4 0.76
5 0.81
6 0.83
7 0.73
8 0.68
9 0.6
10 0.56
11 0.5
12 0.41
13 0.33
14 0.23
15 0.24
16 0.22
17 0.21
18 0.16
19 0.14
20 0.14
21 0.13
22 0.15
23 0.14
24 0.11
25 0.11
26 0.11
27 0.11
28 0.11
29 0.1
30 0.07
31 0.06
32 0.06
33 0.07
34 0.08
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1