Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LG56

Protein Details
Accession A0A3N4LG56    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
187-209AANTAKNSKARRKKSEQVTKETAHydrophilic
212-239GTRVCIYCKKHGHRSKGHVWQDCRKLKQHydrophilic
NLS Segment(s)
PositionSequence
197-198RR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Pfam View protein in Pfam  
PF14223  Retrotran_gag_2  
Amino Acid Sequences MLMVFDALEATQVVVNGYQPPANATAAELARHKHIETESLLLVSDQIMLQIGRHRTAHNIWQYLRKTYYKDTPLSFVHEIHSFNSLSSTLDPSQSISDFIETFETRWMRLHTLTSNARPASFKAIYRMLLENEEAKREYLLASLVTHYPNVVDNLTTKDHLTYEDLKERLIGLAINNQLSNYNGALAANTAKNSKARRKKSEQVTKETAEPGTRVCIYCKKHGHRSKGHVWQDCRKLKQDQQSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.1
4 0.12
5 0.12
6 0.11
7 0.13
8 0.15
9 0.16
10 0.15
11 0.13
12 0.17
13 0.17
14 0.19
15 0.19
16 0.18
17 0.22
18 0.23
19 0.22
20 0.21
21 0.21
22 0.23
23 0.23
24 0.25
25 0.22
26 0.2
27 0.2
28 0.15
29 0.15
30 0.11
31 0.1
32 0.06
33 0.05
34 0.06
35 0.06
36 0.07
37 0.12
38 0.14
39 0.16
40 0.18
41 0.19
42 0.22
43 0.26
44 0.33
45 0.34
46 0.37
47 0.37
48 0.44
49 0.45
50 0.46
51 0.47
52 0.42
53 0.39
54 0.39
55 0.45
56 0.43
57 0.45
58 0.42
59 0.42
60 0.4
61 0.43
62 0.39
63 0.3
64 0.27
65 0.25
66 0.24
67 0.2
68 0.22
69 0.15
70 0.14
71 0.14
72 0.12
73 0.11
74 0.11
75 0.14
76 0.12
77 0.12
78 0.13
79 0.13
80 0.14
81 0.13
82 0.13
83 0.09
84 0.1
85 0.09
86 0.09
87 0.11
88 0.1
89 0.1
90 0.14
91 0.14
92 0.13
93 0.15
94 0.16
95 0.15
96 0.16
97 0.17
98 0.14
99 0.2
100 0.23
101 0.23
102 0.26
103 0.24
104 0.24
105 0.23
106 0.22
107 0.23
108 0.21
109 0.2
110 0.18
111 0.2
112 0.21
113 0.22
114 0.22
115 0.16
116 0.16
117 0.16
118 0.17
119 0.15
120 0.16
121 0.14
122 0.13
123 0.12
124 0.11
125 0.11
126 0.07
127 0.07
128 0.06
129 0.06
130 0.07
131 0.09
132 0.09
133 0.09
134 0.08
135 0.08
136 0.08
137 0.09
138 0.08
139 0.07
140 0.08
141 0.12
142 0.13
143 0.13
144 0.13
145 0.12
146 0.12
147 0.13
148 0.16
149 0.17
150 0.19
151 0.25
152 0.25
153 0.24
154 0.24
155 0.23
156 0.2
157 0.16
158 0.12
159 0.07
160 0.12
161 0.14
162 0.15
163 0.14
164 0.14
165 0.14
166 0.14
167 0.15
168 0.1
169 0.09
170 0.08
171 0.08
172 0.08
173 0.08
174 0.1
175 0.09
176 0.1
177 0.11
178 0.12
179 0.18
180 0.25
181 0.35
182 0.43
183 0.51
184 0.6
185 0.69
186 0.77
187 0.82
188 0.87
189 0.84
190 0.82
191 0.79
192 0.72
193 0.66
194 0.59
195 0.5
196 0.41
197 0.34
198 0.26
199 0.24
200 0.24
201 0.22
202 0.23
203 0.3
204 0.32
205 0.41
206 0.5
207 0.53
208 0.62
209 0.7
210 0.76
211 0.78
212 0.82
213 0.82
214 0.83
215 0.84
216 0.81
217 0.8
218 0.79
219 0.8
220 0.8
221 0.76
222 0.72
223 0.71
224 0.7
225 0.74