Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1W5T5

Protein Details
Accession K1W5T5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
102-121PPPPPPPKLQPGRRRRRIATBasic
NLS Segment(s)
PositionSequence
100-127PPPPPPPPPKLQPGRRRRRIATLLERRR
Subcellular Location(s) plas 15, extr 6, mito 3, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mbe:MBM_09611  -  
Amino Acid Sequences MRNLHGVFWLAIWATPTAGWRLCLDRPKAVETSRSAPSLPVLLPKQTPPPEPRPPPNNNNQHALQRSPDTYHPPSACKSATDTYLPRSGEPSSLPPTGPPPPPPPPPPKLQPGRRRRRIATLLERRRATPGFLRWSSMRPRPCGAGGGLGLGLCLCLCLCLCLFSASSRSLLGSWPWVGGAGRCIITITITIIIIIIVVVVVFFFREEPPRFDCASAALRRLLLSIQSPGGAGVMLRALSCRIPGLETMFWGLRYWECGVGEVWRTPHVAGSFAGSSVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.14
5 0.15
6 0.16
7 0.17
8 0.21
9 0.26
10 0.33
11 0.36
12 0.38
13 0.4
14 0.43
15 0.46
16 0.43
17 0.44
18 0.41
19 0.42
20 0.39
21 0.37
22 0.33
23 0.29
24 0.28
25 0.25
26 0.21
27 0.23
28 0.22
29 0.23
30 0.25
31 0.27
32 0.34
33 0.35
34 0.41
35 0.41
36 0.48
37 0.55
38 0.61
39 0.68
40 0.68
41 0.72
42 0.74
43 0.77
44 0.78
45 0.72
46 0.69
47 0.63
48 0.61
49 0.56
50 0.5
51 0.43
52 0.36
53 0.35
54 0.32
55 0.33
56 0.33
57 0.33
58 0.38
59 0.37
60 0.36
61 0.36
62 0.37
63 0.34
64 0.28
65 0.29
66 0.24
67 0.25
68 0.26
69 0.26
70 0.26
71 0.3
72 0.3
73 0.25
74 0.25
75 0.23
76 0.21
77 0.2
78 0.21
79 0.21
80 0.21
81 0.21
82 0.19
83 0.22
84 0.26
85 0.27
86 0.26
87 0.28
88 0.33
89 0.39
90 0.44
91 0.48
92 0.46
93 0.5
94 0.5
95 0.53
96 0.57
97 0.61
98 0.65
99 0.69
100 0.76
101 0.8
102 0.82
103 0.76
104 0.75
105 0.72
106 0.71
107 0.71
108 0.71
109 0.7
110 0.69
111 0.67
112 0.59
113 0.56
114 0.47
115 0.38
116 0.33
117 0.3
118 0.31
119 0.3
120 0.32
121 0.29
122 0.32
123 0.36
124 0.36
125 0.34
126 0.3
127 0.31
128 0.3
129 0.3
130 0.27
131 0.22
132 0.18
133 0.14
134 0.11
135 0.1
136 0.08
137 0.07
138 0.05
139 0.05
140 0.03
141 0.03
142 0.02
143 0.02
144 0.02
145 0.03
146 0.04
147 0.05
148 0.06
149 0.07
150 0.08
151 0.08
152 0.11
153 0.11
154 0.12
155 0.1
156 0.1
157 0.09
158 0.1
159 0.1
160 0.1
161 0.09
162 0.09
163 0.08
164 0.09
165 0.09
166 0.08
167 0.09
168 0.08
169 0.08
170 0.08
171 0.08
172 0.07
173 0.08
174 0.08
175 0.07
176 0.06
177 0.06
178 0.06
179 0.06
180 0.05
181 0.05
182 0.04
183 0.03
184 0.02
185 0.02
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.04
192 0.05
193 0.12
194 0.15
195 0.19
196 0.23
197 0.28
198 0.29
199 0.28
200 0.28
201 0.25
202 0.3
203 0.28
204 0.27
205 0.24
206 0.23
207 0.23
208 0.23
209 0.2
210 0.14
211 0.13
212 0.13
213 0.13
214 0.12
215 0.12
216 0.12
217 0.11
218 0.09
219 0.07
220 0.05
221 0.06
222 0.05
223 0.05
224 0.06
225 0.07
226 0.08
227 0.09
228 0.1
229 0.09
230 0.1
231 0.12
232 0.17
233 0.16
234 0.17
235 0.2
236 0.2
237 0.2
238 0.19
239 0.19
240 0.14
241 0.17
242 0.18
243 0.18
244 0.17
245 0.18
246 0.19
247 0.21
248 0.23
249 0.23
250 0.22
251 0.21
252 0.22
253 0.21
254 0.25
255 0.22
256 0.2
257 0.18
258 0.21
259 0.19