Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LFK5

Protein Details
Accession A0A3N4LFK5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AKSKNSSQHNQSKKAHRNGIKKPKTNRYPSLHydrophilic
NLS Segment(s)
PositionSequence
14-45KKAHRNGIKKPKTNRYPSLKGVDPKFKRNHRH
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFKRNHRHALHGTMKALKEVKEGLRESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.79
5 0.8
6 0.82
7 0.85
8 0.84
9 0.82
10 0.81
11 0.83
12 0.83
13 0.81
14 0.79
15 0.77
16 0.73
17 0.7
18 0.66
19 0.6
20 0.55
21 0.52
22 0.53
23 0.47
24 0.49
25 0.53
26 0.56
27 0.6
28 0.63
29 0.69
30 0.63
31 0.7
32 0.66
33 0.67
34 0.66
35 0.61
36 0.56
37 0.51
38 0.47
39 0.42
40 0.4
41 0.31
42 0.27
43 0.28
44 0.3
45 0.33