Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1X6X8

Protein Details
Accession K1X6X8    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-79DWQSSCSRRGRPPPRRRRVPCCSRRGRSSWHydrophilic
NLS Segment(s)
PositionSequence
58-67RGRPPPRRRR
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
KEGG mbe:MBM_05707  -  
Amino Acid Sequences MEWRGKKGSTLRCCDVVDGRSRSVHMWRILVRKRASEATSLPDPALSEDDWQSSCSRRGRPPPRRRRVPCCSRRGRSSWVRTWCGTRRRRCC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.49
3 0.43
4 0.43
5 0.38
6 0.36
7 0.32
8 0.33
9 0.32
10 0.31
11 0.34
12 0.27
13 0.28
14 0.31
15 0.39
16 0.44
17 0.49
18 0.47
19 0.42
20 0.43
21 0.43
22 0.39
23 0.33
24 0.29
25 0.26
26 0.26
27 0.24
28 0.21
29 0.17
30 0.16
31 0.13
32 0.13
33 0.08
34 0.08
35 0.08
36 0.09
37 0.09
38 0.1
39 0.11
40 0.11
41 0.16
42 0.2
43 0.25
44 0.3
45 0.41
46 0.51
47 0.61
48 0.71
49 0.77
50 0.83
51 0.89
52 0.91
53 0.9
54 0.89
55 0.9
56 0.88
57 0.88
58 0.88
59 0.84
60 0.83
61 0.79
62 0.77
63 0.76
64 0.75
65 0.73
66 0.71
67 0.69
68 0.64
69 0.67
70 0.67
71 0.67
72 0.67