Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4LY86

Protein Details
Accession A0A3N4LY86    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSVDDLKKLNKNKKLIKKLARKYDAFHydrophilic
NLS Segment(s)
PositionSequence
10-19NKNKKLIKKL
Subcellular Location(s) mito 14, cyto 7.5, cyto_nucl 6, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
IPR016095  Ribosomal_L1_3-a/b-sand  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
CDD cd00403  Ribosomal_L1  
Amino Acid Sequences MSVDDLKKLNKNKKLIKKLARKYDAFLASEPLLRQIPRLLGPGLSKAGKFPTPVSHGEDLAQKVTDVKSTIKFQLKKVLCMGVAVGNVGMTEDQLISNIMLAINYLVSLLKKGWQNVGSLTIKATMSPPKRLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.86
4 0.87
5 0.89
6 0.9
7 0.87
8 0.78
9 0.71
10 0.7
11 0.63
12 0.54
13 0.45
14 0.38
15 0.31
16 0.32
17 0.27
18 0.21
19 0.19
20 0.17
21 0.17
22 0.16
23 0.17
24 0.16
25 0.19
26 0.16
27 0.16
28 0.17
29 0.19
30 0.19
31 0.18
32 0.16
33 0.15
34 0.17
35 0.16
36 0.17
37 0.16
38 0.18
39 0.21
40 0.23
41 0.27
42 0.26
43 0.24
44 0.24
45 0.26
46 0.22
47 0.18
48 0.16
49 0.11
50 0.11
51 0.11
52 0.1
53 0.09
54 0.1
55 0.12
56 0.14
57 0.2
58 0.26
59 0.28
60 0.28
61 0.37
62 0.36
63 0.36
64 0.35
65 0.32
66 0.25
67 0.22
68 0.22
69 0.14
70 0.13
71 0.11
72 0.09
73 0.06
74 0.06
75 0.06
76 0.05
77 0.03
78 0.03
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.05
89 0.05
90 0.04
91 0.04
92 0.04
93 0.04
94 0.05
95 0.06
96 0.06
97 0.11
98 0.15
99 0.17
100 0.23
101 0.24
102 0.25
103 0.26
104 0.33
105 0.3
106 0.27
107 0.26
108 0.23
109 0.22
110 0.21
111 0.23
112 0.25
113 0.27