Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LNQ4

Protein Details
Accession A0A3N4LNQ4    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MKEPRQPKPPKEPKPKKEKPPPKRKRSPSPPINEADBasic
NLS Segment(s)
PositionSequence
4-28PRQPKPPKEPKPKKEKPPPKRKRSP
127-131EKKKK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001766  Fork_head_dom  
IPR030456  TF_fork_head_CS_2  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS00658  FORK_HEAD_2  
PS50039  FORK_HEAD_3  
CDD cd00059  FH_FOX  
Amino Acid Sequences MKEPRQPKPPKEPKPKKEKPPPKRKRSPSPPINEADFPPEALLKPNSSYLILIHEAISNSEKKMLSLPDIYRTIQRKYPYFKLRVTTTGWQSSVRHNLSQSSAFERVQREGKGWLWKITEGFNIEKEKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.93
4 0.93
5 0.94
6 0.93
7 0.94
8 0.94
9 0.94
10 0.95
11 0.94
12 0.94
13 0.93
14 0.93
15 0.91
16 0.89
17 0.84
18 0.77
19 0.72
20 0.62
21 0.52
22 0.46
23 0.36
24 0.27
25 0.22
26 0.18
27 0.14
28 0.15
29 0.16
30 0.12
31 0.13
32 0.14
33 0.15
34 0.14
35 0.14
36 0.11
37 0.13
38 0.13
39 0.12
40 0.11
41 0.11
42 0.11
43 0.11
44 0.13
45 0.1
46 0.09
47 0.12
48 0.12
49 0.11
50 0.13
51 0.13
52 0.13
53 0.16
54 0.17
55 0.18
56 0.2
57 0.21
58 0.24
59 0.26
60 0.27
61 0.27
62 0.3
63 0.3
64 0.35
65 0.43
66 0.45
67 0.47
68 0.48
69 0.48
70 0.48
71 0.46
72 0.44
73 0.41
74 0.38
75 0.37
76 0.35
77 0.33
78 0.31
79 0.34
80 0.38
81 0.35
82 0.32
83 0.29
84 0.3
85 0.31
86 0.33
87 0.29
88 0.26
89 0.27
90 0.26
91 0.29
92 0.29
93 0.3
94 0.32
95 0.31
96 0.27
97 0.28
98 0.32
99 0.38
100 0.38
101 0.39
102 0.36
103 0.37
104 0.37
105 0.36
106 0.35
107 0.29
108 0.29
109 0.3
110 0.36
111 0.39