Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4LBY3

Protein Details
Accession A0A3N4LBY3    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-60KHTNIKFTSNKKKLRKALPPGLTHydrophilic
NLS Segment(s)
PositionSequence
47-53NKKKLRK
Subcellular Location(s) plas 10, E.R. 7, mito 6, cyto_nucl 2, nucl 1.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025187  DUF4112  
Pfam View protein in Pfam  
PF13430  DUF4112  
Amino Acid Sequences MSNLISKFVVKKILKETAENKFGKQDGLFERTPARKMKHTNIKFTSNKKKLRKALPPGLTQAEQEILVKVKRRAYMLDMSLFSMCGLRFGWSSVIGLVPAVGDVLDLFLALMVVRTASEASLPSSIRAKMLFNIILDFLIGLVPFLGDLADAAYKCNTRNAIALENYLRKRGQENIRKSGIPAPPDLSLPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.53
4 0.52
5 0.6
6 0.56
7 0.5
8 0.46
9 0.45
10 0.41
11 0.35
12 0.33
13 0.29
14 0.34
15 0.33
16 0.29
17 0.36
18 0.36
19 0.4
20 0.4
21 0.39
22 0.41
23 0.48
24 0.57
25 0.61
26 0.63
27 0.69
28 0.67
29 0.72
30 0.71
31 0.74
32 0.75
33 0.73
34 0.76
35 0.75
36 0.8
37 0.79
38 0.82
39 0.82
40 0.81
41 0.82
42 0.78
43 0.72
44 0.67
45 0.62
46 0.53
47 0.43
48 0.34
49 0.24
50 0.18
51 0.15
52 0.12
53 0.1
54 0.11
55 0.15
56 0.17
57 0.21
58 0.22
59 0.23
60 0.24
61 0.26
62 0.3
63 0.28
64 0.28
65 0.24
66 0.23
67 0.22
68 0.2
69 0.16
70 0.12
71 0.09
72 0.07
73 0.07
74 0.07
75 0.07
76 0.08
77 0.09
78 0.08
79 0.08
80 0.07
81 0.07
82 0.06
83 0.05
84 0.04
85 0.03
86 0.03
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.03
103 0.03
104 0.03
105 0.04
106 0.04
107 0.06
108 0.08
109 0.09
110 0.1
111 0.12
112 0.12
113 0.13
114 0.14
115 0.13
116 0.12
117 0.16
118 0.16
119 0.14
120 0.15
121 0.14
122 0.13
123 0.12
124 0.1
125 0.06
126 0.05
127 0.04
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.02
135 0.02
136 0.04
137 0.06
138 0.06
139 0.07
140 0.1
141 0.11
142 0.12
143 0.16
144 0.17
145 0.17
146 0.21
147 0.23
148 0.27
149 0.27
150 0.31
151 0.32
152 0.38
153 0.38
154 0.38
155 0.35
156 0.31
157 0.33
158 0.38
159 0.43
160 0.46
161 0.53
162 0.57
163 0.61
164 0.61
165 0.6
166 0.59
167 0.53
168 0.46
169 0.41
170 0.36
171 0.32